Clone BO28558 Report

Search the DGRC for BO28558

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:285
Well:58
Vector:pDNR-Dual
Associated Gene/TranscriptCG6729-RA
Protein status:BO28558.pep: Imported from assembly
Sequenced Size:2866

Clone Sequence Records

BO28558.complete Sequence

2866 bp assembled on 2011-08-05

GenBank Submission: KX794462

> BO28558.complete
GAAGTTATCAGTCGACATGTTGGATGATTACTACACCTGGACTTACCCGG
ATATACCCGAAAATGTGGCACAGGAGCTGCTGCAGCTGAACGGTTCGCTG
GTAGTGGTCGGAATCGTTGGCCGGTCGGATTGCGACCAGGCCAACAAGAT
GGTGGCTTTCGGCATGGAGCCGCCTAGTGAGCACACACCCAAGGACGGCC
AGATGCAGTGTTACTACAAGCCGGGTACCTCCATCCTGCTGCTGCACTTC
GAAAGCACCTACGACGCGGAGATTGCTGGCCAGATGATAGATGTCTGCAT
AGAGGATGTGGATACTCCCTTCGACATCGACAGCTTCTTCGAGGGGATAC
GATGTCGCTTCGTGCGCATGATGCTGCTGGCCCTGCACGTTTGCCACATT
GTGGTGTATGTGGAAACTGGGCAGACGTTTGATCCGACACTAATCACCGT
GTTCCAATTGGCCAAGTTCGCCAGGGAACAGCATTTGATGCAGTTCTTGC
CACAAATGCTTAGAGAAACGCCTGCCGCCAGAATGAGCGAGCGCACACGA
CTGTGCACTCCCAGGATTCTCTTCCTTTTCGAAAACTTTCCGAGCGACGA
GCCAAAGACACGCGAATGCGTCTCTACATACGAGTTCCAGATGGAGGACT
GCATCTATGAGTTGTTGCGCCACCACAACATCGTGACCAATAGCAGCAGC
AACTCGCTTGTGGCACTTCCCAATAACAAACAGTTCGTCTTCTTCAACGC
ACACGAAGAGTTGCGTGAGGACACGCTGATGAAGGCCGTCGAATGCCTCA
ATGAGACAATGTACAAGCCGGATCTCAAAGAGGAGGAGGAAGACCTAGAG
ATCTTGGCGCTGGCTCCCTTCGATGGCTTCGTCAAACCCTTCGCCTTGCC
GGTCGATGAGAAGGAGTGGGATAATCAGCAGTACAAGAAGGACCACACCG
TGTGGAACTTTCTGGAGCGACACGTTCAGGACGCCTTGATGGGTTGCTTT
GAAGCGGGTTCCTTCAAGCAGCATGCCCAGCAGGGTACGTTCCAACTCCT
AAATAGCAAGGAGTGGCACGACTGCATGGCCACGATGCACACGTTGCTGG
TGGAGAACACTAAGGATCCAAACCTAGAAACCAGCAATGAGGAATATAAA
AACTTCTTGAAGAACTTCGACGAGAGCTTGAACTATGAGAAAAAATTTTG
GGCTCACCTCTGCGAACTGGGCCTAAAGAAGGGCATCGCCGCCTACAAGA
ACGCTGCACCCGAGAACTATGGCAGTGCCACGCACCGACAACTACTGGCG
GAGGCCACCCTTGCCTTCGAGGAGGAAGGTCGCGGTCCACAGGCGCAGGC
GGCACTGGCGAAGCTGGCATCCATTTGCCACAAGCACTGGCAGGATGGAC
GTCAGCAGTGCGAGCAGCTTAGCCTGCGCTCTCATCCCTGCACACTGCCC
AAGAAAGTGCCACACGAGAAGCACAACAGCGGAGTGATCCACATCTCCAG
CTGCAATTGCGGTCGCACTCAGGGCCGTCGAGAGGATCCGTTCAACCTGC
GGCAAGCGAACTACGAGTTCTACGAGCACATTGCTCAAATGTGCAACTTG
TGCGTTAAGGTCAAGCAGTACCAGTTCCCCATTTTCGAGCCATCGGTTAG
TGATTACCGGGCGGCGGCCTTTGAAGCTGCATTTCCTCTGTTGAACAATG
GAAAAAGTGGTGCGCCGCAAGACGAAGATGCGGAGGAGGATGAAGCGGAG
GAAGAGGAGGGTCAGGAGCAAGAGCAACCCACGGAAGAGCAGCTTCAGAA
TACCGCCAGCAACTGCTGCTCCCAGCCCTTGTCGCCCACCTTTGGGTCCG
ATCTAAACATGTCCATTGCCGGATTTGGAGCATCACTGAAGGAATCGCAG
GCTAGTTCCGAGCAACTGTTGAATTCCGAGCAGAATACCACTAGCAGTGG
CACCTCCAGCGCCGACACGGATAACGAACTCGTGGTTGAGCTCCAGGAGC
CAGCGAAGAAGGAGGCTCGCGAAGACGCCGGTCCAGCCCATGCCGTTTCC
ACGTCCACAACTGAGTATCTGCCGGGCTTGGTCCACACTGTCAGCAACTT
TGGCCTGCTGCCGCTCTTCCCAAGTTGGTCCCTGGCCTGCGTGGGTCCCA
GTTCCATTTATAGCCACAATACCGGGCTGCAGGAGCACTTCCAGAGCGGC
TTCTTGTCCGGCGCCAATTTCCTGCTGCCCTGGGACGTCCAGTTGCGTCT
AGTTCACGCGCCCAAGCAGCAATACCAGCAGCAGCATCACGGAAAGAAGC
AGCAGCGGTGGAAGAAGCAGGGCGACAGGCTTTCGCTCAAAATATTCGTC
GGCATGGAGTACGAGTGCTCCCGCGGACACCGGTTCATGATGTGCGCCCC
AGATCGCGTGCTGCGCGGTGGAGCAGACATCGAACGCGAAACCTGCAGCA
TGGTAGTCCACAACAACATGCCGCTCTATTATCCCTGTCCCTGCCGATCC
CAGAACAACTTTCTGGCGCAGCTGATGCGCATCCATGTGGTGACGCCCAA
GGCGCCGGTCAACATCATCGTGGATCCCAAGGTGTGCGTGGGAAGGTACA
CCTTCACCATGGGCAGCATAGTACCGCCTCGCCTCTCACAGAGCGCCTAC
TGGATCATCCGATTGCCCTACGTCTACCAGGGTGACGATGTGCTCATCGC
TCCGCCCGAGCAACTGGATCCGGGCTATCCGCTGACCGGTGGCTATCTAC
TGCCTGGGATGTTCGGAGTGGTGGAGACGGATCCCACACTGGATTTGAAT
GAACCTGACAAGATGGGCGCTTCTGCAGCGGGAAATTTCACTAGGATTGC
AAGCTTTCTAGACCAT

BO28558.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 01:38:14
Subject Length Description Subject Range Query Range Score Percent Strand
CG6729-RA 2835 CG6729-PA 1..2832 17..2848 14070 99.8 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 01:38:16
Subject Length Description Subject Range Query Range Score Percent Strand
CG6729-RA 2993 CG6729-RA 62..2893 17..2848 14070 99.8 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 01:38:11
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 10740882..10742535 2848..1195 8240 99.9 Minus
2L 23513712 2L 10742693..10743770 1147..70 5330 99.6 Minus
2L 23513712 2L 10743822..10743874 69..17 265 100 Minus
2L 23513712 2L 10742588..10742634 1194..1148 235 100 Minus
Blast to na_te.dros performed 2014-11-27 01:38:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6765..6819 2265..2319 131 70.9 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6721..6764 2263..2306 130 77.3 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6798..6861 2265..2327 128 68.8 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6744..6785 2265..2306 120 76.2 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6827..6891 2255..2319 118 64.6 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6834..6889 2265..2320 118 67.9 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6858..6913 2265..2320 118 67.9 Plus
roo 9092 roo DM_ROO 9092bp 1046..1105 2262..2320 117 68.3 Plus

BO28558.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-08-05 12:00:46 Download gff for BO28558.complete
Subject Subject Range Query Range Percent Splice Strand
CG6729-RA 66..2892 22..2850 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 04:58:35 Download gff for BO28558.complete
Subject Subject Range Query Range Percent Splice Strand
CG6729-RA 67..2893 22..2850 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 02:29:18 Download gff for BO28558.complete
Subject Subject Range Query Range Percent Splice Strand
CG6729-RA 67..2893 22..2850 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 02:29:18 Download gff for BO28558.complete
Subject Subject Range Query Range Percent Splice Strand
2L 10743822..10743869 22..69 100   Minus
2L 10742693..10743770 70..1147 99 <- Minus
2L 10742588..10742634 1148..1194 100 <- Minus
2L 10740880..10742535 1195..2850 99 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 04:58:35 Download gff for BO28558.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 10743822..10743869 22..69 100   Minus
arm_2L 10742693..10743770 70..1147 99 <- Minus
arm_2L 10742588..10742634 1148..1194 100 <- Minus
arm_2L 10740880..10742535 1195..2850 99 <- Minus

BO28558.pep Sequence

Translation from 16 to 2866

> BO28558.pep
MLDDYYTWTYPDIPENVAQELLQLNGSLVVVGIVGRSDCDQANKMVAFGM
EPPSEHTPKDGQMQCYYKPGTSILLLHFESTYDAEIAGQMIDVCIEDVDT
PFDIDSFFEGIRCRFVRMMLLALHVCHIVVYVETGQTFDPTLITVFQLAK
FAREQHLMQFLPQMLRETPAARMSERTRLCTPRILFLFENFPSDEPKTRE
CVSTYEFQMEDCIYELLRHHNIVTNSSSNSLVALPNNKQFVFFNAHEELR
EDTLMKAVECLNETMYKPDLKEEEEDLEILALAPFDGFVKPFALPVDEKE
WDNQQYKKDHTVWNFLERHVQDALMGCFEAGSFKQHAQQGTFQLLNSKEW
HDCMATMHTLLVENTKDPNLETSNEEYKNFLKNFDESLNYEKKFWAHLCE
LGLKKGIAAYKNAAPENYGSATHRQLLAEATLAFEEEGRGPQAQAALAKL
ASICHKHWQDGRQQCEQLSLRSHPCTLPKKVPHEKHNSGVIHISSCNCGR
TQGRREDPFNLRQANYEFYEHIAQMCNLCVKVKQYQFPIFEPSVSDYRAA
AFEAAFPLLNNGKSGAPQDEDAEEDEAEEEEGQEQEQPTEEQLQNTASNC
CSQPLSPTFGSDLNMSIAGFGASLKESQASSEQLLNSEQNTTSSGTSSAD
TDNELVVELQEPAKKEAREDAGPAHAVSTSTTEYLPGLVHTVSNFGLLPL
FPSWSLACVGPSSIYSHNTGLQEHFQSGFLSGANFLLPWDVQLRLVHAPK
QQYQQQHHGKKQQRWKKQGDRLSLKIFVGMEYECSRGHRFMMCAPDRVLR
GGADIERETCSMVVHNNMPLYYPCPCRSQNNFLAQLMRIHVVTPKAPVNI
IVDPKVCVGRYTFTMGSIVPPRLSQSAYWIIRLPYVYQGDDVLIAPPEQL
DPGYPLTGGYLLPGMFGVVETDPTLDLNEPDKMGASAAGNFTRIASFLDH

BO28558.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 07:16:09
Subject Length Description Subject Range Query Range Score Percent Strand
CG6729-PA 944 CG6729-PA 1..944 1..944 5056 100 Plus