Clone BO28559 Report

Search the DGRC for BO28559

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:285
Well:59
Vector:pDNR-Dual
Associated Gene/TranscriptCG4705-RB
Protein status:BO28559.pep: Imported from assembly
Sequenced Size:2941

Clone Sequence Records

BO28559.complete Sequence

2941 bp assembled on 2011-08-04

GenBank Submission: KX799917

> BO28559.complete
GAAGTTATCAGTCGACATGCCGCCCACGGAGACACTGCGTCCGGGAGAAC
GCGGAACAGCCGGTGGACCGGGAGCAGGAGCACCCGAACAAACGTACATC
GTCAGGCAGAGCAACAAATACTATGAACACCGAGATTCCCAGGCCACGGC
CATGTCGGTTGATTACTCGGGTCAGTGGGTGCTCCTCGCGGGCCGTGGTC
ACCTGGCTTTGCAGCGTTTGGGACAGGACGATGGGTCTCTGCGACGACAT
GAACGGCAATCGAAGTACGAGGTGTCCGTAGCAGAGTTTGCCATATGTCC
CAGTCGCAAAGAGTACTGCGCCATAGCGACTAGCCAGCACATAGACATCG
TTCGCTGGGGCACTGCGGAACCACACTACGAGATGTCCTTGCGTGGGCAT
ACTCGAACAGTGACCGACATTGACTGGCACGGCAAGGATCCGAATCTGCT
GGTCAGCTGCTCAATAGACACATTTTCTCATATTTGGGACTTAAGGGAGC
CCAGGAAACCAGCCCTGTCCTTGAATGCCGTGTGCATGTCTGGTGCTACA
CAAGTGGGATTCAACCGCGTTTCGGGCAACCTTTTGGCTGCTGCCCATGA
TGGAGATTTACGCATCTGGGATATTCGCAAGGGTAGTTGCCCGACGCACT
ATATCACAGCACATTTAAATAGAGTGCATGGCATCAATTGGAGCCACAAA
AGGGAGACCTGCTTGGCAACCGCCAGTCAGGATGGAACGGTCAAGTACTT
TGATGTATGTAATCCTCGCAGGGCCGAGAAGATCATTACAACCATGTCGC
CCGTTTGGAGAGCGAGATACACGCCTATTGGCAACGGTCTGGTTAGCATT
GTGGTGCCCCATTTGGGACGCGGAGAGAATAGTTTGCTGCTCTGGAGCAA
CAGCAAGCAAACGGACCCTATTTGTTCCTTCGTGGGGCACACCGATGTCA
TTCTTGACTTTGCCTGGCGTCCAAATCGTGAAAGTTCCAATGAAATAGAA
CTGGTCACTTGGTCCAGGGATCGCACGCTGCGGGTGTGGAAGATCGATGA
TAATATGCTAAAGCTTTGCGAACCGTCTGCGGAAGAAATAGAATCCCGTT
TCGAGCCCGATCTCAGTGAGTTAAGAGTGCCTACTCCTCCAGAATTCCTG
CATCCACGATCAATTTTGGTTGCCGCTTCGTTGCCCATATCCACGGGTGA
CGGTGCTTGTAATACCTTGCCCATGGCTCGCTCCCCGAGCTTTGGAGGTG
GCTACTATCGCAGGGAAGAGCCCCACATAGCCAGATCACTAACAGATCAA
CCCACGTGTTCGCTGCACCACGAATTCTCGCTGCTCAACACAAACATGCC
TCATGTGGAGGTAGACACACTAGATGCCATAAAGCGGTACGCCTGCTTCA
AGATTTGCGCCGGTGGACACACGGTTATTTTACAAGTGACTTTCACGACA
TCGTATCCAAGTCCTAGTGCTCCGCCGGACTTTCAGCTTTGCCAGGGAAC
CACTCTGTCCAGTGAAGTTAGTGGAGTTCTGCTAAAAGTGCTCCGTTGCA
ATGCATTGCAACGGGTCAAGAAATCCCGCACGTGCCTGGAACAATGCCTA
CGTGCTCTAGTGGCGGCTATGAAGAAAAAGGTGGCCGCTGTAGGCGGAGC
GGATCGTAGCCAACTGCTCCTGCAATCCCCTCGGCTGGAAGGAGCTTTGT
CGAGCACCCTGCACGATGCCTGCATTCCATATCCGCGGACGTCAGGGGTC
CATTTCAATGCCATTGGTATGCTGACCACTTTCGCCCAACCAGTGAACAA
CAAAAGGCTGACCCTGCGGCAACACACCGCATTGACTCCACGGACTTTTT
CATCGATTAATGGTAGTGGATTGCTAGGCAATGTGATGGCCACCGCCCAG
AGGGAAGCTAACGCCTCCTTTTACCTCCAGGAGAGGATGATTTCGGGAAA
ACCGGGCAAGCAGCGAGCCATCCGACAGATGAATGGAAGTCCGGTGGTTC
ACGTATACGACACAAGTAGCTTACTCCACATTAGTCGGAGAATGGCTCGG
GAGTTCTCCCTCGATAAGTGCAACATAGCAGAAACGTGTCGTAAAAATGG
TGAGATCTGTCGCCAGCATGGGCGCTTGGACTTGGTGCCCGTGTGGCTAT
TGGCGGAACTGATAGCCACACCCCAAATTCCACATGAAACACTCAACGAT
CTGCTGTTCTACAAAGATCCCTTCAAGAAATCTCTGCTGGAATCACTAAT
AATGCATTATGCTATCTCCGGTGACATACAGACTGCTGTGCTGCTGGCTT
GTTTGTTTGACAAGTGCCCCACGGGTGGCGGTGCCATTATGGAGAAGACA
GTTCGACTTCCGCCGCAGCTTAACTCGCAAATTTCACCGTATCACACGGT
CCTGCCGCTTGACGTCAAGTCATCTTCTTCATCGAACACTTGGCAGCAAC
TTAAGCAACTACGCAGCAACTCTTGGTCCGACTCCCTGGATTTGGAGATT
AAGCAAATCCAGTCTGATGCATACGCTTGCTCATTGATTAGACGGACTAA
GATGCCACTGTTTGATCAATTTAAGCGCGCCTATGCCGAAATTTTATTTG
GCTGGCAGTTGCTTTCGAAGCGGGCTTTGATCCTCAAGCACACGCAGAAT
ACACCACCTCCAGTCCAGGGTGTGGAATTCGTTACCGAGTGCAGGAAGTG
TGCCAAGCCCAAACGGACGCCCAAATGCGAGCCCTGCAAGCGACCCGTAC
TCTTCTGCGTCCTCTGCCGTTTGCCTGTGAAAGGAGCAGCCAATGCGTGT
CTGGCTTGTGGCCATGGCGGTCACATTGATCACATGATGCAGTGGTTTGA
GAAACACAATGTCTGTGCTACGTGTGGCTGCAAGTGCTTGGAGCGCACCT
CAGAGCTGCTAGCCCTACTCAGCGCAAGCTTTCTAGACCAT

BO28559.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 00:56:46
Subject Length Description Subject Range Query Range Score Percent Strand
CG4705-RD 2910 CG4705-PD 1..2907 17..2923 14535 100 Plus
CG4705-RB 2910 CG4705-PB 1..2907 17..2923 14535 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 00:56:47
Subject Length Description Subject Range Query Range Score Percent Strand
CG4705-RD 3292 CG4705-RD 124..3030 17..2923 14535 100 Plus
CG4705-RB 3197 CG4705-RB 124..3030 17..2923 14535 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 00:56:45
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 11092782..11094635 998..2851 9270 100 Plus
2L 23513712 2L 11091567..11091878 17..328 1560 100 Plus
2L 23513712 2L 11092209..11092492 540..823 1420 100 Plus
2L 23513712 2L 11091941..11092152 328..539 1060 100 Plus
2L 23513712 2L 11092552..11092727 823..998 880 100 Plus
2L 23513712 2L 11094757..11094834 2846..2923 375 98.7 Plus
Blast to na_te.dros performed on 2014-11-27 00:56:46 has no hits.

BO28559.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-08-04 15:53:54 Download gff for BO28559.complete
Subject Subject Range Query Range Percent Splice Strand
CG4705-RB 126..3032 17..2925 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 04:39:30 Download gff for BO28559.complete
Subject Subject Range Query Range Percent Splice Strand
CG4705-RB 124..3030 17..2925 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 02:14:21 Download gff for BO28559.complete
Subject Subject Range Query Range Percent Splice Strand
CG4705-RB 124..3030 17..2925 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 02:14:21 Download gff for BO28559.complete
Subject Subject Range Query Range Percent Splice Strand
2L 11094763..11094834 2852..2925 97   Plus
2L 11092782..11094635 998..2851 100 -> Plus
2L 11092553..11092726 824..997 100 -> Plus
2L 11092209..11092492 540..823 100 -> Plus
2L 11091942..11092152 329..539 100 -> Plus
2L 11091567..11091878 17..328 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 04:39:30 Download gff for BO28559.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 11094763..11094834 2852..2925 97   Plus
arm_2L 11092782..11094635 998..2851 100 -> Plus
arm_2L 11092553..11092726 824..997 100 -> Plus
arm_2L 11092209..11092492 540..823 100 -> Plus
arm_2L 11091942..11092152 329..539 100 -> Plus
arm_2L 11091567..11091878 17..328 100 -> Plus

BO28559.pep Sequence

Translation from 16 to 2941

> BO28559.pep
MPPTETLRPGERGTAGGPGAGAPEQTYIVRQSNKYYEHRDSQATAMSVDY
SGQWVLLAGRGHLALQRLGQDDGSLRRHERQSKYEVSVAEFAICPSRKEY
CAIATSQHIDIVRWGTAEPHYEMSLRGHTRTVTDIDWHGKDPNLLVSCSI
DTFSHIWDLREPRKPALSLNAVCMSGATQVGFNRVSGNLLAAAHDGDLRI
WDIRKGSCPTHYITAHLNRVHGINWSHKRETCLATASQDGTVKYFDVCNP
RRAEKIITTMSPVWRARYTPIGNGLVSIVVPHLGRGENSLLLWSNSKQTD
PICSFVGHTDVILDFAWRPNRESSNEIELVTWSRDRTLRVWKIDDNMLKL
CEPSAEEIESRFEPDLSELRVPTPPEFLHPRSILVAASLPISTGDGACNT
LPMARSPSFGGGYYRREEPHIARSLTDQPTCSLHHEFSLLNTNMPHVEVD
TLDAIKRYACFKICAGGHTVILQVTFTTSYPSPSAPPDFQLCQGTTLSSE
VSGVLLKVLRCNALQRVKKSRTCLEQCLRALVAAMKKKVAAVGGADRSQL
LLQSPRLEGALSSTLHDACIPYPRTSGVHFNAIGMLTTFAQPVNNKRLTL
RQHTALTPRTFSSINGSGLLGNVMATAQREANASFYLQERMISGKPGKQR
AIRQMNGSPVVHVYDTSSLLHISRRMAREFSLDKCNIAETCRKNGEICRQ
HGRLDLVPVWLLAELIATPQIPHETLNDLLFYKDPFKKSLLESLIMHYAI
SGDIQTAVLLACLFDKCPTGGGAIMEKTVRLPPQLNSQISPYHTVLPLDV
KSSSSSNTWQQLKQLRSNSWSDSLDLEIKQIQSDAYACSLIRRTKMPLFD
QFKRAYAEILFGWQLLSKRALILKHTQNTPPPVQGVEFVTECRKCAKPKR
TPKCEPCKRPVLFCVLCRLPVKGAANACLACGHGGHIDHMMQWFEKHNVC
ATCGCKCLERTSELLALLSASFLDH

BO28559.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 07:12:30
Subject Length Description Subject Range Query Range Score Percent Strand
CG4705-PD 969 CG4705-PD 1..969 1..969 5156 100 Plus
CG4705-PB 969 CG4705-PB 1..969 1..969 5156 100 Plus
CG7609-PB 776 CG7609-PB 18..311 40..338 184 24.3 Plus
CG7609-PC 777 CG7609-PC 18..311 40..338 184 24.3 Plus
CG10931-PA 345 CG10931-PA 83..303 114..348 167 25 Plus