Clone BO28561 Report

Search the DGRC for BO28561

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:285
Well:61
Vector:pDNR-Dual
Associated Gene/TranscriptAtpalpha-RD
Protein status:BO28561.pep: Imported from assembly
Sequenced Size:2551

Clone Sequence Records

BO28561.complete Sequence

2551 bp assembled on 2011-08-04

GenBank Submission: KX797385

> BO28561.complete
GAAGTTATCAGTCGACATGCCGGCCAAAGTTAATAAAAAGGAGAATTTAG
ATGATCTCAAACAGGAGTTGGATATCGATTTTCATAAAATCTCTCCTGAG
GAATTGTATCAGCGCTTTCAGACACATCCCGAAAATGGTCTAAGTCACGC
CAAGGCCAAGGAAAACTTGGAGCGCGATGGTCCCAATGCGCTGACGCCAC
CCAAGCAGACGCCCGAATGGGTGAAGTTCTGTAAGAACCTGTTCGGTGGC
TTCGCCATGTTGCTGTGGATCGGTGCTATTCTCTGCTTTGTGGCCTATTC
TATCCAGGCCAGCACCAGCGAGGAGCCGGCCGACGATAATTTGTATCTGG
GTATTGTACTTTCCGCTGTCGTCATCGTGACGGGCATTTTCTCATACTAT
CAGGAATCGAAAAGTTCTAAGATCATGGAATCGTTCAAGAACATGGTACC
CCAGTTCGCCACCGTCATCCGCGAGGGCGAGAAACTCACGCTGCGCGCTG
AGGATCTCGTTCTGGGCGATGTCGTTGAGGTGAAGTTCGGCGACCGTATC
CCCGCTGATATCCGCATCATCGAGGCGCGCAACTTCAAGGTGGACAACTC
CTCGCTGACCGGCGAGTCGGAGCCGCAGTCCCGCGGTGCCGAGTTCACCC
ATGAGAATCCGCTGGAGACCAAGAATCTGGCCTTCTTCTCCACCAACGCC
GTCGAGGGCACTGCCAAGGGTGTGGTCATCAGCTGTGGCGATCACACCGT
CATGGGCCGCATTGCTGGCCTTGCCTCCGGTCTAGACACCGGCGAGACGC
CCATTGCCAAGGAGATCCACCATTTCATCCACCTTATTACCGGCGTGGCC
GTGTTCCTGGGCGTCACCTTCTTCGTGATTGCCTTCATCCTGGGCTACCA
CTGGCTGGACGCTGTCATCTTTTTGATCGGTATCATCGTCGCCAACGTGC
CCGAGGGTCTGCTGGCCACCGTAACTGTGTGCCTGACCCTTACCGCCAAG
CGTATGGCCTCAAAGAACTGTCTGGTGAAGAATCTGGAGGCCGTGGAGAC
CCTTGGCTCCACATCGACCATCTGCTCCGATAAGACCGGCACCCTCACCC
AGAACCGAATGACGGTCGCCCACATGTGGTTCGATAATCAGATCATCGAG
GCCGACACAACTGAGGATCAGTCGGGTGTTCAATACGATAGAACCAGCCC
TGGATTCAAGGCGCTCTCTCGCATTGCCACTCTCTGTAACCGTGCCGAGT
TCAAGGGAGGCCAAGATGGCGTCCCAATCCTCAAGAAAGAAGTCAGTGGA
GATGCCTCCGAGGCTGCTCTGCTCAAGTGCATGGAACTGGCTCTGGGCGA
TGTGATGAACATTCGCAAGCGTAATAAGAAGATTGCCGAGGTGCCCTTCA
ACTCCACCAACAAATACCAAGTGTCCATCCACGAAACCGAGGATACCAAC
GATCCCCGCTACTTGCTCGTAATGAAGGGAGCCCCCGAACGTATCTTGGA
GCGCTGCTCTACCATTTTTATCAACGGCAAGGAGAAGGTTCTGGACGAGG
AGATGAAGGAGGCGTTCAACAATGCCTACATGGAACTCGGTGGACTGGGT
GAGCGCGTGCTCGGTTTCTGTGACTTTATGCTGCCATCCGACAAGTATCC
CAACGGCTTTAAGTTCAACACCGACGACATCAACTTCCCCATCGATAATC
TGCGTTTCGTCGGCCTTATGTCCATGATTGATCCCCCACGTGCTGCCGTG
CCCGATGCCGTTGCCAAGTGCCGATCGGCCGGCATCAAGGTCATCATGGT
CACCGGCGATCACCCGATCACTGCCAAGGCCATCGCCAAGTCTGTCGGTA
TTATATCCGAGGGCAACGAGACCGTCGAGGACATTGCCCAGCGCCTCAAC
ATACCCGTCTCTGAAGTGAATCCCCGCGAGGCCAAGGCCGCCGTCGTCCA
TGGCGCTGAGCTTCGTGATGTGTCCAGCGACCAGCTGGATGAAATCCTCC
GCTACCACACCGAGATCGTCTTCGCCCGTACCTCGCCCCAGCAGAAATTG
ATCATTGTCGAGGGTTGCCAGCGCATGGGAGCTATTGTGGCCGTGACTGG
TGATGGTGTCAACGATTCTCCCGCTCTGAAGAAAGCCGATATCGGTGTTG
CCATGGGTATAGCCGGTTCCGATGTGTCCAAGCAGGCTGCTGACATGATT
TTGCTGGACGACAACTTTGCCTCCATTGTGACTGGTGTGGAGGAGGGTCG
CCTGATCTTCGACAACCTGAAAAAGTCCATCGCCTACACCCTGACCTCCA
ACATTCCCGAAATCTCGCCCTTCCTGGCCTTCATCCTCTGCGATATACCA
CTGCCACTGGGAACCGTGACGATTCTTTGCATCGATCTGGGCACTGACAT
GGTAAGTTTAGACCTCTGCCCCAAACCCAAGCTCCATCGAAGATTAAAGT
TAAAGTTGCTATTAAGTCAGTATCATTCGAGCAAGTTATATAGTTATACA
AGTTGTAGCCCATCCCAGTTAATAGTTAAGAACGCAAGCTTTCTAGACCA
T

BO28561.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 00:59:42
Subject Length Description Subject Range Query Range Score Percent Strand
Atpalpha-RD 2520 CG5670-PD 1..2517 17..2533 12585 100 Plus
Atpalpha-RK 3009 CG5670-PK 1..2387 17..2403 11935 100 Plus
Atpalpha-RJ 3009 CG5670-PJ 1..2387 17..2403 11935 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 00:59:43
Subject Length Description Subject Range Query Range Score Percent Strand
Atpalpha-RD 5099 CG5670-RD 547..3063 17..2533 12585 100 Plus
Atpalpha-RK 3721 CG5670-RK 307..2693 17..2403 11935 100 Plus
Atpalpha-RJ 5545 CG5670-RJ 229..2615 17..2403 11935 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 00:59:40
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 20964255..20966040 401..2186 8930 100 Plus
3R 32079331 3R 20966396..20966745 2184..2533 1750 100 Plus
3R 32079331 3R 20963927..20964194 137..404 1340 100 Plus
3R 32079331 3R 20963737..20963857 17..137 605 100 Plus
4 1348131 4 3376..3668 2021..2313 340 74.4 Plus
4 1348131 4 2350..2499 986..1135 225 76.7 Plus
2R 25286936 2R 23931450..23931536 1127..1041 195 81.6 Minus
2R 25286936 2R 23930387..23930450 2157..2094 185 85.9 Minus
Blast to na_te.dros performed 2014-11-27 00:59:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dbuz\Newton 1510 Dbuz\Newton NEWTON 1510bp 1060..1114 83..140 130 72.4 Plus
Dbuz\Newton 1510 Dbuz\Newton NEWTON 1510bp 398..451 140..84 125 71.9 Minus

BO28561.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-08-04 15:53:59 Download gff for BO28561.complete
Subject Subject Range Query Range Percent Splice Strand
Atpalpha-RD 520..3036 17..2535 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 04:41:21 Download gff for BO28561.complete
Subject Subject Range Query Range Percent Splice Strand
Atpalpha-RD 547..3063 17..2535 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 02:15:48 Download gff for BO28561.complete
Subject Subject Range Query Range Percent Splice Strand
Atpalpha-RD 547..3063 17..2535 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 02:15:48 Download gff for BO28561.complete
Subject Subject Range Query Range Percent Splice Strand
3R 20966398..20966745 2186..2535 99   Plus
3R 20964258..20966039 404..2185 100 -> Plus
3R 20963927..20964193 137..403 100 -> Plus
3R 20963737..20963856 17..136 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 04:41:21 Download gff for BO28561.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 16792120..16792467 2186..2535 99   Plus
arm_3R 16789980..16791761 404..2185 100 -> Plus
arm_3R 16789649..16789915 137..403 100 -> Plus
arm_3R 16789459..16789578 17..136 100 -> Plus

BO28561.pep Sequence

Translation from 16 to 2551

> BO28561.pep
MPAKVNKKENLDDLKQELDIDFHKISPEELYQRFQTHPENGLSHAKAKEN
LERDGPNALTPPKQTPEWVKFCKNLFGGFAMLLWIGAILCFVAYSIQAST
SEEPADDNLYLGIVLSAVVIVTGIFSYYQESKSSKIMESFKNMVPQFATV
IREGEKLTLRAEDLVLGDVVEVKFGDRIPADIRIIEARNFKVDNSSLTGE
SEPQSRGAEFTHENPLETKNLAFFSTNAVEGTAKGVVISCGDHTVMGRIA
GLASGLDTGETPIAKEIHHFIHLITGVAVFLGVTFFVIAFILGYHWLDAV
IFLIGIIVANVPEGLLATVTVCLTLTAKRMASKNCLVKNLEAVETLGSTS
TICSDKTGTLTQNRMTVAHMWFDNQIIEADTTEDQSGVQYDRTSPGFKAL
SRIATLCNRAEFKGGQDGVPILKKEVSGDASEAALLKCMELALGDVMNIR
KRNKKIAEVPFNSTNKYQVSIHETEDTNDPRYLLVMKGAPERILERCSTI
FINGKEKVLDEEMKEAFNNAYMELGGLGERVLGFCDFMLPSDKYPNGFKF
NTDDINFPIDNLRFVGLMSMIDPPRAAVPDAVAKCRSAGIKVIMVTGDHP
ITAKAIAKSVGIISEGNETVEDIAQRLNIPVSEVNPREAKAAVVHGAELR
DVSSDQLDEILRYHTEIVFARTSPQQKLIIVEGCQRMGAIVAVTGDGVND
SPALKKADIGVAMGIAGSDVSKQAADMILLDDNFASIVTGVEEGRLIFDN
LKKSIAYTLTSNIPEISPFLAFILCDIPLPLGTVTILCIDLGTDMVSLDL
CPKPKLHRRLKLKLLLSQYHSSKLYSYTSCSPSQLIVKNASFLDH

BO28561.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 07:12:47
Subject Length Description Subject Range Query Range Score Percent Strand
Atpalpha-PD 839 CG5670-PD 1..839 1..839 4290 100 Plus
Atpalpha-PK 1002 CG5670-PK 1..796 1..796 4067 100 Plus
Atpalpha-PJ 1002 CG5670-PJ 1..796 1..796 4067 100 Plus
Atpalpha-PA 1041 CG5670-PA 40..835 1..796 4067 100 Plus
Atpalpha-PH 1002 CG5670-PH 1..796 1..796 4067 100 Plus