Clone BO28562 Report

Search the DGRC for BO28562

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:285
Well:62
Vector:pDNR-Dual
Associated Gene/Transcriptboi-RB
Protein status:BO28562.pep: Imported from assembly
Sequenced Size:3028

Clone Sequence Records

BO28562.complete Sequence

3028 bp assembled on 2011-08-05

GenBank Submission: KX799786

> BO28562.complete
GAAGTTATCAGTCGACATGGCTGAAATCAGGCTAGTTGTGGTTCTACTGG
TCCTTATGACCACCTGTATCTATACACTTCAAGCCAGTGACAGTAATTCC
TCCGTGGCAACCACCTTGGGCGTTTTGTTCGAGAGGGCTCCCGAATCAGC
GGTGGCCCCGAAAGGAGATGAGGTGGTCTTCGAGTGCGAGCTGAATCTGA
AACCTGATCGCCTGGAGTGGCGGTTTAGACGTGGTGATTCCTCGGAGCCC
TATCTATACCTAAGGCCCTCGGCTGGCTATAACGTGACCAGCGGAAGCGA
TGGTCTTGCCTGGAGACTGCGCATCTATGTGAGTGCCCAAACGGCTGGGG
ACTACCAGTGTGTGGCTTGGTATGGCCCGGGTGCACTGGCTTCCACGCCA
GCCCGCTTGGCCTTGGTCTCGATTGCTTTGGACGTCGGCCAGGGATCCAT
GGGGGCCAGGAGCTCCATCCGCTGGAGCGTGGCGCCCAAAAACTGCCTGC
TCATTCGTTGCGGCAGCGTAATATCGAATCCGCCGGCTATTTGGAGCTTC
TACAGAAACGGAAAGAAGCTACCTCAATCGGAGCTGCTGCCTGGCGCTGC
GGGGGCATTGGTTTTGGATACGGTCACCGCCAAAGATGCGGGTAACTACT
CGTGCGTGGCCACGAACTCCATAACAGGCGATGAACTTAGGCTCCCCCAA
ACTATTGAACTAAGAGTGGACTACACAGATAGGACACCTCCGTACTTTCT
ACAACGTCCACCCATCGAATACTCAGCTCGTCCCGGAGAAACAGTGGTGC
TCGAGTGTCCTGGCGTGGGATCCCCACGACCCCGAGTCATTTGGAGTAGT
CCCAATGTGGTTGAGATCTATAATAATAGAAGCACCATCCTGTCCTACGG
CCTGCAAATCACCGATGTGAAGCCCGAGGATCAGGGTTCCTATATCTGCA
TGCTGGACAATGGTATTGCACCACCGATCGATCACACCATCAAGTTGAGT
GTTTTGCAGCGGCCCACGATCTTAAGAGGACCGGCCGCCACTCTGACGAA
TGAGAGCAATCCTTTGCTGCTGGATTGCTCCGCCTCGGGGAATCCCCAAC
CCGATATTTATTGGCTTATAAACGGTGAGGATGCCACCAAAGATCCGGAG
GCTGTGGTGGATAACCGGAGCCTGCAGCTGAAGCGAGTTCAAAAGCGTCA
CGCTGGCGTGGTTCAGTGCTTTGCAAAGAACATTTTGGGAGAGACGAGCG
AGGGAAACATATTGCGCGTGAATCCCCTGGAAATCACCGGCGAGGATGAC
GAACCACTTGGCGAAGTTCCCGTGTGGCCAGTTCATGAATCCAACACTGG
AATGGGCACCTCGTCAACATCTGGAGGCTCCAAAAACAAGAGCGGCAGAC
GAAAGTTTAAGGCGAGCATGGTGCCTCCGTCACGACCCAATGTCACCCGT
CTGTCGGACGAGTCCGTGATGCTGCGCTGGAGTGTGCCACAAAACTCTGG
ACTCCAGATCACCTTTTTCAAGGTGCAGTATCGCATGTTGGGCGACGGAA
AAAATCGGAGGAAGAACTGGCAGACGACCAGCGACAATATCCCGTACGGA
AACGCGCACGGATCCGGGCCTGGCCAGGGGAACAGTCACTGGCGGGCGCG
GAACCGGGACAGGGAGTATGAAATGGGCAATCCGCCCAAGAACTTCACCT
CCTCCGTTACGGGACTGACCGCCGGCAAGTACTACCGCTTCCGGATCGTG
GCGGTGTACTCCAATAACGACAACAAGGAGGGCAACACCTCCCTCAAGTT
CTTCCTGCAGAATGGAACGTCCAAGTCGAATCTGCCAGTGCCGGAACTAC
GCGAGGTGGAGACGCTTTCCGAGTCGGCCGTGGTGCTCCATTGGTCCCTG
GTATCCTCGACTCAAAATGAGGATATAGACGGGTACTATGCCTACTATAG
GCCAGCGGACTCAGCAGCGGAGTATTTGAAGGCCACGGTGGATGGCGGAA
TGAGCAGGAGCTTCAAGATAGACCTCCTTCGTCCAGGAACCCCTTATGAG
TTCAAATTGCAATCGTTCAACTCCGACGCAGCCTCTGAATTCAGTGCTAT
TCGGCAAGCGAGGACCAGAAAAACGCACGAGCAACCGGCTTCATCTTCGG
CCACGCCAGTGCCAGCCAATAAGGCAGTGGAACAGCACCAGAACTCCTTA
TATCCACTGATCGCAGGTGCCGCTGGCGGAGGCATACTACTCCTCATCGC
CTCATTGGTGGTCTGCCTTTGCCTAAAGAGACGGGAAAACTCTCAGCCGG
AGGATGAGAACAAACCGCAATTGGAACACATTCAAGCGGACTTTGTTACC
TCCGCCGTCCTGGGAGTTGGTGGCCACCACAAAAGTGGCGATGTAAGGCG
CCTCAACGGAGTGATTCCGAGGATGAATATTACGCCCAATCCGCTGGCCC
AGGAAACGGCATCCGATAAGAACAACTCTGGACTGCATCAGAATGGCCTT
CACCACGCACAGCCGTACCATCCGCCTGGCACGCCCACTCTGATGCACAA
GCGACTGGACTACCACCAGCAGCCGCCGCCGGTGCCTCCGCACTCGGCCT
ATTACCAACAGGCACCCACGCACCAGCCGTCGCCGATGATGGAGCGCAGT
GTCAGGGGTCACCAGCAGCCCGGGGGCTTTCATATGGAGGAGGGCACACC
CACGCCGACCAGGATACCATCCCTGCGGCGACAGCGACGCACCTCGGGCA
ACCAGCAGGTGCACAACAGCCACAGCAATCTCAATATTGGCCTGAGCCAC
CACAACAACAACAACAACAACCTGCCGCCGCACCACCAGCATCTGCACCA
CCACCCCGGCCATCCGGGTGGCCTGGTGGGCATACCCATCGTGCCAGGGA
GCCCTAGGGTCCAGAGATCGCCGATGCCGAGCAGGGCGATGATCAAGAGG
ACGCGCCTGGGCAGCCACACGGACAACATATCGTCGGGCAGTCTGAACAG
TATTGAGGTGGCAAGCTTTCTAGACCAT

BO28562.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 01:39:28
Subject Length Description Subject Range Query Range Score Percent Strand
boi-RF 2997 CG32796-PF 1..2994 17..3010 14955 100 Plus
boi-RE 2997 CG32796-PE 1..2994 17..3010 14955 100 Plus
boi-RB 2997 CG32796-PB 1..2994 17..3010 14955 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 01:39:30
Subject Length Description Subject Range Query Range Score Percent Strand
boi-RF 4509 CG32796-RF 629..3622 17..3010 14955 100 Plus
boi-RE 4316 CG32796-RE 436..3429 17..3010 14955 100 Plus
boi-RB 4223 CG32796-RB 343..3336 17..3010 14955 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 01:39:25
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 2450903..2452129 1243..17 6120 99.9 Minus
X 23542271 X 2446890..2447598 2120..1412 3545 100 Minus
X 23542271 X 2445054..2445595 3010..2469 2710 100 Minus
X 23542271 X 2446642..2446824 2303..2121 915 100 Minus
X 23542271 X 2450670..2450840 1412..1242 855 100 Minus
X 23542271 X 2446411..2446578 2470..2303 840 100 Minus
Blast to na_te.dros performed on 2014-11-27 01:39:27 has no hits.

BO28562.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-08-05 12:00:47 Download gff for BO28562.complete
Subject Subject Range Query Range Percent Splice Strand
boi-RE 396..3389 17..3012 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 04:59:05 Download gff for BO28562.complete
Subject Subject Range Query Range Percent Splice Strand
boi-RB 343..3336 17..3012 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 02:29:38 Download gff for BO28562.complete
Subject Subject Range Query Range Percent Splice Strand
boi-RB 343..3336 17..3012 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 02:29:38 Download gff for BO28562.complete
Subject Subject Range Query Range Percent Splice Strand
X 2450903..2452129 17..1243 99   Minus
X 2450670..2450838 1244..1412 100 <- Minus
X 2446890..2447597 1413..2120 100 <- Minus
X 2446642..2446824 2121..2303 100 <- Minus
X 2446411..2446577 2304..2470 100 <- Minus
X 2445051..2445593 2471..3012 99 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 04:59:05 Download gff for BO28562.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 2344936..2346162 17..1243 99   Minus
arm_X 2344703..2344871 1244..1412 100 <- Minus
arm_X 2340923..2341630 1413..2120 100 <- Minus
arm_X 2340675..2340857 2121..2303 100 <- Minus
arm_X 2340444..2340610 2304..2470 100 <- Minus
arm_X 2339084..2339626 2471..3012 99 <- Minus

BO28562.pep Sequence

Translation from 16 to 3028

> BO28562.pep
MAEIRLVVVLLVLMTTCIYTLQASDSNSSVATTLGVLFERAPESAVAPKG
DEVVFECELNLKPDRLEWRFRRGDSSEPYLYLRPSAGYNVTSGSDGLAWR
LRIYVSAQTAGDYQCVAWYGPGALASTPARLALVSIALDVGQGSMGARSS
IRWSVAPKNCLLIRCGSVISNPPAIWSFYRNGKKLPQSELLPGAAGALVL
DTVTAKDAGNYSCVATNSITGDELRLPQTIELRVDYTDRTPPYFLQRPPI
EYSARPGETVVLECPGVGSPRPRVIWSSPNVVEIYNNRSTILSYGLQITD
VKPEDQGSYICMLDNGIAPPIDHTIKLSVLQRPTILRGPAATLTNESNPL
LLDCSASGNPQPDIYWLINGEDATKDPEAVVDNRSLQLKRVQKRHAGVVQ
CFAKNILGETSEGNILRVNPLEITGEDDEPLGEVPVWPVHESNTGMGTSS
TSGGSKNKSGRRKFKASMVPPSRPNVTRLSDESVMLRWSVPQNSGLQITF
FKVQYRMLGDGKNRRKNWQTTSDNIPYGNAHGSGPGQGNSHWRARNRDRE
YEMGNPPKNFTSSVTGLTAGKYYRFRIVAVYSNNDNKEGNTSLKFFLQNG
TSKSNLPVPELREVETLSESAVVLHWSLVSSTQNEDIDGYYAYYRPADSA
AEYLKATVDGGMSRSFKIDLLRPGTPYEFKLQSFNSDAASEFSAIRQART
RKTHEQPASSSATPVPANKAVEQHQNSLYPLIAGAAGGGILLLIASLVVC
LCLKRRENSQPEDENKPQLEHIQADFVTSAVLGVGGHHKSGDVRRLNGVI
PRMNITPNPLAQETASDKNNSGLHQNGLHHAQPYHPPGTPTLMHKRLDYH
QQPPPVPPHSAYYQQAPTHQPSPMMERSVRGHQQPGGFHMEEGTPTPTRI
PSLRRQRRTSGNQQVHNSHSNLNIGLSHHNNNNNNLPPHHQHLHHHPGHP
GGLVGIPIVPGSPRVQRSPMPSRAMIKRTRLGSHTDNISSGSLNSIEVAS
FLDH

BO28562.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 07:16:12
Subject Length Description Subject Range Query Range Score Percent Strand
boi-PF 998 CG32796-PF 1..998 1..998 5281 100 Plus
boi-PE 998 CG32796-PE 1..998 1..998 5281 100 Plus
boi-PB 998 CG32796-PB 1..998 1..998 5281 100 Plus
boi-PG 1105 CG32796-PG 1..821 1..821 4277 99.8 Plus
boi-PA 547 CG32796-PA 15..547 466..998 2850 99.8 Plus
boi-PG 1105 CG32796-PG 908..1105 801..998 1022 92.4 Plus