Clone BO28564 Report

Search the DGRC for BO28564

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:285
Well:64
Vector:pDNR-Dual
Associated Gene/TranscriptCG5018-RA
Protein status:BO28564.pep: Imported from assembly
Sequenced Size:2122

Clone Sequence Records

BO28564.complete Sequence

2122 bp assembled on 2011-08-04

GenBank Submission: KX799825

> BO28564.complete
GAAGTTATCAGTCGACATGACGAATAATGCGAAGAAGGAACCCCAGCAAA
GGGGCAAGCATCAGGTGCATAATGTGCGCTTCTACACTATAAAGCCGCGT
GAAATTGTCAGCTTGGCGTATAGTAAATCGAGCAAGTGCCTCGCTCTGAG
TCGTGCAACACCCGTCATTGAGCTATGGAACCTGGAGCACGCCCCGTATT
TGGATCGTGTAATCCACCTGCCCACCGATTCTCATGTGGAATCTATAGCC
TGGGCGGGAAACCGCTTATTTTCCGTGGATTTAAGTGGTAAACTGATCGA
GTGGGATGTGATTAAGCTAAAACAACGATATGAGCACTCGCCCACTGGCA
ATGCTCTCTGGAGTATCGATGTGAATCCCGCGGAAACGGATATTGCCATT
GGCTCAGAGGAAGGGCACATCAACATCCTGAGTATTGAGAATGACGAAAT
CACCTATAAATCCCTATTTAACAAGCAAAAAGGTCGCGTTCTCTGCATCA
AGTTTGATAAGACTGGAACTAAACTGGTGACCGGCACTGAGGGATTTGTT
CGCATTTGGAACGTCCTCAAGGGAACCACTCTGCACACGATGACCCTATC
CGAAAAGAACGTAATAGTTTGGTCCCTGCAGGTGCTATCCGATAATACGA
TTATTGCCGGTGATTCAGCGGGATTTGTTACCGTTTGGGATGCGGATAAC
GCGACACAGATAGATTCCACACGAGTTCTGGATAAAAACGTATTTGCCCT
GGCTGTGAATAATAAGGAGGATCGATTAGTTTGCAGTGGAATGCAGCCGC
CGCTCATCCGGATTTTCAGCAAAACCAAGATAAAGCGGGAAGAGTCCACC
AGCGAGCGTTGGATTAAATTCCTACAGCGCGATGCCCACAAACACTATGT
GAAATCCCTGTTGGTTATCGACGATCAAATTTATTCGGGAGGCAGGGATG
GCATATTGACCATTACGTCCAGTGAACGAATGCAGGCACATTTGTCGCAG
CATGCTCCCTTTCTGAAAGGTTCCGTAGCTTCCATGGCAATCAGTAAAAA
GCTTTTGCTTTTGCGATATCCCAACAGCGTGCACCTGTGGCGCTTGGGTT
CTGTGGCCCCGCAAGGCGAGGACAAGAAGAAACCCTGGGCACTGCCCGTC
GGCCACACGGAGGAACAACTTCTGGAGCTGCCACCCCAGAAACTTCTCCA
ACTAAATGTCAAAGAGCACAACTTTATACAGTCTGCTGCCATTTCATCAG
ATGCAAACTGGATTTGCTACTCTACCTTAAAGGAACTCCGAATCAGTCGT
TTGAAAAGTGATCCCCTGCAGGTGGAGCGTCTGGTAGACGATCTTCCCGA
GGAACTTCAACCAGCCAGTCATATAATTTTCACAAAGCAGGGAGATCTAG
TGCTGCTCAACCCGCAGAACAATCATCTAAGTTGGTTTACTTTAGAGGAA
GATCTGGTTACATTCAAATATACCATCGATTTGAGTGAGAAGTGTAAGAA
TACGATTAGCCACGTGGTTATCTCTTCGCATGGCGAATACATTGTGGCTG
CGAGCTCAGACCACATAATATCAGTTTGGAAACTACATGGAAAACAATAC
AAGCACCTGCTGAACCTACCAAGACACCGAGCAGGTACCACCGCCCTATC
CATGCACGAGGATTACCCACGCGTGGTGGTCGCCTACGCCAATGGCCAGC
TGGTGGAGTACGATTTGGTCAATCGGATATTCACCTGTGAAACTAATGAG
TACCTGATACCCGAGACCAGGCGCCATTGCATCAATGGAATCAGCCTGGA
TCCACAAAATCGTAATATATTTATTGTTCACACCGAGGGCAATTTGTATG
TGTTGGAGAGGGATCAGCATCTGGATCCCAAAGAGCTTGTGAGCAACAGC
AAGTCTAAAAAGTTATCAAATGGAAACCGCTCTTCAGTTGATGGCGGCTC
AAAAGGCCTGAGCCTCAAGACGACTCTGTCACGACAGCACCTGGTGCACG
TGTCTCGCCTGAGCCCTAACGAACTTGTCAACGTCAGCATTTCGACAAAC
AATCTGTTGGCTCCGCTGCCGCCGCCGTACCAGCGGAAGAAGTTCGGTGC
CTCGGCAAGCTTTCTAGACCAT

BO28564.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 00:59:58
Subject Length Description Subject Range Query Range Score Percent Strand
l(3)72Dn-RA 2091 CG5018-PA 1..2088 17..2104 10440 100 Plus
l(3)72Dn-RB 2100 CG5018-PB 1..2097 17..2104 10315 99.6 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 00:59:59
Subject Length Description Subject Range Query Range Score Percent Strand
l(3)72Dn-RA 2314 CG5018-RA 111..2198 17..2104 10440 100 Plus
l(3)72Dn-RB 2323 CG5018-RB 111..2207 17..2104 10315 99.6 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 00:59:56
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 16226587..16228421 1987..153 9175 100 Minus
3L 28110227 3L 16228491..16228627 153..17 685 100 Minus
3L 28110227 3L 16226242..16226361 2104..1985 600 100 Minus
Blast to na_te.dros performed on 2014-11-27 00:59:57 has no hits.

BO28564.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-08-04 15:53:59 Download gff for BO28564.complete
Subject Subject Range Query Range Percent Splice Strand
CG5018-RA 63..2150 17..2106 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 04:41:30 Download gff for BO28564.complete
Subject Subject Range Query Range Percent Splice Strand
l(3)72Dn-RA 111..2198 17..2106 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 02:15:55 Download gff for BO28564.complete
Subject Subject Range Query Range Percent Splice Strand
l(3)72Dn-RA 111..2198 17..2106 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 02:15:55 Download gff for BO28564.complete
Subject Subject Range Query Range Percent Splice Strand
3L 16228491..16228627 17..153 100   Minus
3L 16226587..16228420 154..1987 100 <- Minus
3L 16226240..16226358 1988..2106 98 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 04:41:30 Download gff for BO28564.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 16221591..16221727 17..153 100   Minus
arm_3L 16219687..16221520 154..1987 100 <- Minus
arm_3L 16219340..16219458 1988..2106 98 <- Minus

BO28564.pep Sequence

Translation from 16 to 2122

> BO28564.pep
MTNNAKKEPQQRGKHQVHNVRFYTIKPREIVSLAYSKSSKCLALSRATPV
IELWNLEHAPYLDRVIHLPTDSHVESIAWAGNRLFSVDLSGKLIEWDVIK
LKQRYEHSPTGNALWSIDVNPAETDIAIGSEEGHINILSIENDEITYKSL
FNKQKGRVLCIKFDKTGTKLVTGTEGFVRIWNVLKGTTLHTMTLSEKNVI
VWSLQVLSDNTIIAGDSAGFVTVWDADNATQIDSTRVLDKNVFALAVNNK
EDRLVCSGMQPPLIRIFSKTKIKREESTSERWIKFLQRDAHKHYVKSLLV
IDDQIYSGGRDGILTITSSERMQAHLSQHAPFLKGSVASMAISKKLLLLR
YPNSVHLWRLGSVAPQGEDKKKPWALPVGHTEEQLLELPPQKLLQLNVKE
HNFIQSAAISSDANWICYSTLKELRISRLKSDPLQVERLVDDLPEELQPA
SHIIFTKQGDLVLLNPQNNHLSWFTLEEDLVTFKYTIDLSEKCKNTISHV
VISSHGEYIVAASSDHIISVWKLHGKQYKHLLNLPRHRAGTTALSMHEDY
PRVVVAYANGQLVEYDLVNRIFTCETNEYLIPETRRHCINGISLDPQNRN
IFIVHTEGNLYVLERDQHLDPKELVSNSKSKKLSNGNRSSVDGGSKGLSL
KTTLSRQHLVHVSRLSPNELVNVSISTNNLLAPLPPPYQRKKFGASASFL
DH

BO28564.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 07:12:49
Subject Length Description Subject Range Query Range Score Percent Strand
l(3)72Dn-PA 696 CG5018-PA 1..696 1..696 3615 100 Plus
l(3)72Dn-PB 699 CG5018-PB 1..699 1..696 3601 99.6 Plus