Clone BO28565 Report

Search the DGRC for BO28565

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:285
Well:65
Vector:pDNR-Dual
Associated Gene/TranscriptCG6621-RA
Protein status:BO28565.pep: Imported from assembly
Sequenced Size:2650

Clone Sequence Records

BO28565.complete Sequence

2650 bp assembled on 2011-08-05

GenBank Submission: KX795604

> BO28565.complete
GAAGTTATCAGTCGACATGAACTTCGATTACATCGGCCAGGCCCTGGGCT
ACCACGGGCAGCCGCTCCAGAAGATCTGGGACGACGAGCGCGGCGTGGAC
GACCTGCGGCTGATGGGACTCACCCAGGTGAACTACGGGGTCTACCAGGA
GCGGCAGAAGTACTTCACCTTCCAGGAGCGGGCTAAGCGATTGAAGATGC
ACCAGTTTCTGGCCAGGAAGGCCACCGATTTGTATGATCGCACGCTGGTG
GCCAATGTTATGGAGGATTCCCTGCTGGCACAAGGCAACACATACATGAC
TCAGATGGCCCCCTTCGAGTTCTTCCTCAATGTGAAGGACAAACGCAAGG
GATGGGCGCACCGATTGTCTGCACTGAAGCAGGGCGACATCATCTACACG
CAGGTGACACGGCTGGCCAGCGGCAACCGGCTCATAGTGAAGCCACTCTG
CACTGCTGAGCCCAAACACGCCTACTTGGCTGACATTCCCATAAAGGCCG
TGATCCTGCAGGACTTCTGGGGTCCCTTGCCCCTGGACAAGCAGGGCAAT
CCGCGCAGCTTTGTCCAGAATGACATCTTGCGCTGTGAGATAAACAACAT
ATCCGCGGATACCGAGCGGCTCTCTCTGAACATGATCGGCATGTTCAATA
AGGTGCCGGATTTAAAGTTTGGTCTCTGCGACTTTAAGGAGTTGCCCAAG
TATTATAGTAAAATACATAACCTGGATCATCCATCTGCGTCTCACTACGA
GGATGAGCTAAACAAAGCCTTAGAGTTTGAAAATCCCAACTACGATTTGC
TGTTCCAAATGAACGGACTGCAGCCAAACGAGAATCTGTCACTGATGTCA
TATTTAAGGGCGGGATTCCCGGAGGAGGAGAACGCCGCGGAGTTGCGACA
GAAGCAGGCCTCCCAGTGGGCCTTCCGCTCCGTGGCTGATGGCATCGAAC
ACTTTAAGAACGGCCAACAGGTCGAGGCCTTTCAGTGCCTGAACAAGGCC
TTAAACATTGATCCGCGCAATGTTGAGGCGCTGGTGGCCCGCGGTGCCCT
CTACGCGAATCGCGGCAGCTTTCTTAAAGGGCTGCAGGACTTTGAGAAGG
CTCTGCACCTGAACAAGTATCACGTGAACGCGCGCAAATACATGGGCGAA
ACGCTGGTGGCTCTGGGTCGCAGCTACGAAGAGGAGAATCGCATAGCCGA
AGCCGTCAAGGCCTATAGCGATTGCCTAAATCTGTTGCCGCTGCACGAAG
AAGCACGCCAGTCCCTGGACGCACTGCATCGAAGTGGAGACGGTAAGCGT
AGAATAAGCACTGAGCCGTCGAACATGACCGGTGGCCAGTCCTCGGACGA
GTCCTCCTCATCGAGTGCCAGTGATAGTGAATGCGAAGATTCGGCTGGTA
AGCCCAAGTCAAACATTAGTCAGCCCTTTTATGCCCAACACAAGCTAAAG
CAATCGGGAGATGAAAAGTTGGCCGTCATTGATGCCCATAAGGCCAATGA
GTTCCGTTTGGACGACGACGAGACCGTGTCGAGTGTGCGGAAGCTTTTGC
GCGAGGCGAGCAAACACAAGAAGGCCAAGAAGAAGGGAAAGAAGAAAAAG
GACAAGAAGGAGCGAAGGAGGTCCAGGACCAAGTCCGAAACGGAGGATCC
CATTGAATTGCTTAAGAAGATCGACTTCCAGGAGGCCCTCAGACAAGACA
ACAAGCTCATGAACAGCACCAGGAGCGATGAGGAACGCAAGGCCAAGATC
AAGAGCTATCTAAAAGAAGGAGGAAAAGAGTCACCACCTCCCCCGCCACC
AATGAAAAAAACAGCAGTCTCATCTAGAAAGTCAAGCTTTGACAATGTGG
GACCCAGCACATCGCGTCATGCGGCCTCCGTTGTTGGCTTTGGAGGCGCC
CAGCCACCACCAGCGCCCAAGTTTCTGGGGCAAAAGAAACATCCGGAGCC
GGCACCCAAGCTCTCCTTTCAGATTAAGAAACGACCGCTGCAGATGGACA
AGCTGGGAATGCTGCGTCTAGCAGCGCCAGCGGAGCCACTCAAGGGAGGA
CGGAGCAGCAGCTCCCGCAGCCGGAGTAGGAGTAGAAGCCGCTCGCGAAG
TCGCTCACGTAATCGTCGGCTTGGAAGGAGCACGCGTTCGTCGCTCAGGA
GCCGGCGTTCTGGCTCGAGGTCCAGATCGATTAGCCGATCACGGTCGCGT
CGCCGACGTACCTACTCCCGTTCGCGCAGCCCCTCGCCACGCAGTTACGG
AAATCGCTTTGTGATTGGACGCTACCGTAATCGCCGAACTCGGCGTTCGC
GCTCCTTTCATCGTCGGCGTTCTCCATCGCCCATTTTGAAACGCCGATCG
CCTTCACCATTTGTGCCCCGTCGCACACCATCGCCGGCATCCCGCTATCG
ACGCAGCCGATCCCGCAGTCGCTCCCGCTCACGCAGTCGGAGTCCTCGAC
GCTTTCAGTCTCGCTACATGCCGAGGGATCGTGGCTCCGTGAATCGAAGC
AGGTACTCCTGGCACAATCCCCATAAACGCAGTGTATCACGCACCGTGGA
GCCAAATGGCAAAGATGAAAGGGCAGCTACTCCGCCGAAAAAGGGTGTTG
CTGATGATAGATCTGGACGAGAAGAAAGGGCGGCAAGCTTTCTAGACCAT

BO28565.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 01:40:22
Subject Length Description Subject Range Query Range Score Percent Strand
CG6621-RA 2619 CG6621-PA 1..2616 17..2632 13080 100 Plus
CG6621-RB 2607 CG6621-PB 1..2604 17..2632 12865 99.5 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 01:40:23
Subject Length Description Subject Range Query Range Score Percent Strand
CG6621-RA 3115 CG6621-RA 350..2965 17..2632 13080 100 Plus
CG6621-RB 3103 CG6621-RB 350..2953 17..2632 12865 99.5 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 01:40:18
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 10889918..10890845 2632..1705 4640 100 Minus
3R 32079331 3R 10891514..10891981 1394..927 2340 100 Minus
3R 32079331 3R 10891094..10891392 1692..1394 1495 100 Minus
3R 32079331 3R 10892914..10893182 285..17 1345 100 Minus
3R 32079331 3R 10892085..10892306 927..706 1110 100 Minus
3R 32079331 3R 10892639..10892853 497..283 1075 100 Minus
3R 32079331 3R 10892363..10892576 708..495 1070 100 Minus
Blast to na_te.dros performed on 2014-11-27 01:40:20 has no hits.

BO28565.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-08-05 12:12:19 Download gff for BO28565.complete
Subject Subject Range Query Range Percent Splice Strand
CG6621-RA 349..2964 17..2634 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 04:59:24 Download gff for BO28565.complete
Subject Subject Range Query Range Percent Splice Strand
CG6621-RA 350..2965 17..2634 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 02:29:50 Download gff for BO28565.complete
Subject Subject Range Query Range Percent Splice Strand
CG6621-RA 350..2965 17..2634 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 02:29:50 Download gff for BO28565.complete
Subject Subject Range Query Range Percent Splice Strand
3R 10892915..10893182 17..284 100   Minus
3R 10892640..10892851 285..496 100 <- Minus
3R 10892363..10892574 497..708 100 <- Minus
3R 10892085..10892303 709..927 100 <- Minus
3R 10891514..10891980 928..1394 100 <- Minus
3R 10891082..10891391 1395..1704 97 <- Minus
3R 10889916..10890845 1705..2634 99 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 04:59:24 Download gff for BO28565.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 6718637..6718904 17..284 100   Minus
arm_3R 6718362..6718573 285..496 100 <- Minus
arm_3R 6718085..6718296 497..708 100 <- Minus
arm_3R 6717807..6718025 709..927 100 <- Minus
arm_3R 6717236..6717702 928..1394 100 <- Minus
arm_3R 6716804..6717113 1395..1704 97 <- Minus
arm_3R 6715638..6716567 1705..2634 99 <- Minus

BO28565.pep Sequence

Translation from 16 to 2650

> BO28565.pep
MNFDYIGQALGYHGQPLQKIWDDERGVDDLRLMGLTQVNYGVYQERQKYF
TFQERAKRLKMHQFLARKATDLYDRTLVANVMEDSLLAQGNTYMTQMAPF
EFFLNVKDKRKGWAHRLSALKQGDIIYTQVTRLASGNRLIVKPLCTAEPK
HAYLADIPIKAVILQDFWGPLPLDKQGNPRSFVQNDILRCEINNISADTE
RLSLNMIGMFNKVPDLKFGLCDFKELPKYYSKIHNLDHPSASHYEDELNK
ALEFENPNYDLLFQMNGLQPNENLSLMSYLRAGFPEEENAAELRQKQASQ
WAFRSVADGIEHFKNGQQVEAFQCLNKALNIDPRNVEALVARGALYANRG
SFLKGLQDFEKALHLNKYHVNARKYMGETLVALGRSYEEENRIAEAVKAY
SDCLNLLPLHEEARQSLDALHRSGDGKRRISTEPSNMTGGQSSDESSSSS
ASDSECEDSAGKPKSNISQPFYAQHKLKQSGDEKLAVIDAHKANEFRLDD
DETVSSVRKLLREASKHKKAKKKGKKKKDKKERRRSRTKSETEDPIELLK
KIDFQEALRQDNKLMNSTRSDEERKAKIKSYLKEGGKESPPPPPPMKKTA
VSSRKSSFDNVGPSTSRHAASVVGFGGAQPPPAPKFLGQKKHPEPAPKLS
FQIKKRPLQMDKLGMLRLAAPAEPLKGGRSSSSRSRSRSRSRSRSRSRNR
RLGRSTRSSLRSRRSGSRSRSISRSRSRRRRTYSRSRSPSPRSYGNRFVI
GRYRNRRTRRSRSFHRRRSPSPILKRRSPSPFVPRRTPSPASRYRRSRSR
SRSRSRSRSPRRFQSRYMPRDRGSVNRSRYSWHNPHKRSVSRTVEPNGKD
ERAATPPKKGVADDRSGREERAASFLDH

BO28565.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 07:16:15
Subject Length Description Subject Range Query Range Score Percent Strand
CG6621-PA 872 CG6621-PA 1..872 1..872 4507 100 Plus
CG6621-PB 868 CG6621-PB 1..868 1..872 4470 99.5 Plus
CG6695-PB 715 CG6695-PB 255..546 526..812 222 32.4 Plus
CG6695-PA 961 CG6695-PA 255..546 526..812 222 32.4 Plus
Srp54-PA 513 CG4602-PA 268..451 668..870 212 36.9 Plus