Clone BO28567 Report

Search the DGRC for BO28567

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:285
Well:67
Vector:pDNR-Dual
Associated Gene/TranscripteIF-4E-RA
Protein status:BO28567.pep: Imported from assembly
Sequenced Size:818

Clone Sequence Records

BO28567.complete Sequence

818 bp assembled on 2011-07-13

> BO28567.complete
GAAGTTATCAGTCGACATGCAGAGCGACTTTCACAGAATGAAGAACTTTG
CCAATCCCAAGTCCATGTTCAAAACCAGCGCCCCCAGCACCGAGCAGGGT
CGTCCGGAACCACCAACTTCGGCTGCAGCGCCCGCCGAGGCTAAGGATGT
CAAGCCCAAGGAGGACCCACAGGAGACTGGTGAACCAGCAGGCAACACTG
CAACCACTACTGCTCCTGCCGGCGACGATGCTGTGCGCACCGAGCATTTA
TACAAACACCCGCTCATGAATGTCTGGACGCTGTGGTACCTTGAAAACGA
TCGGTCCAAGTCCTGGGAGGACATGCAAAACGAGATCACCAGCTTCGATA
CCGTCGAGGACTTCTGGAGCCTATACAACCACATCAAGCCCCCATCAGAG
ATCAAGCTGGGTAGTGACTACTCGCTATTCAAGAAGAACATTCGTCCCAT
GTGGGAGGATGCAGCCAACAAACAGGGCGGTCGTTGGGTAATTACCCTTA
ACAAAAGCTCCAAGACCGATCTGGATAACCTATGGCTCGATGTGCTGCTC
TGCCTGATTGGTGAGGCCTTCGATCACTCCGATCAGATCTGCGGCGCTGT
TATAAACATTCGCGGCAAGAGCAACAAGATATCCATCTGGACTGCCGACG
GAAACAACGAGGAAGCTGCCCTTGAGATTGGTCACAAGCTGCGCGATGCC
TTGCGTCTGGGACGCAACAACTCGCTGCAGTATCAGTTGCACAAGGACAC
GATGGTCAAGCAGGGCTCCAACGTGAAATCGATCTACACTTTGGGCAAGC
TTCCAGACCATTCCTTTG

BO28567.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 16:52:27
Subject Length Description Subject Range Query Range Score Percent Strand
eIF-4E-RI 780 CG4035-PI 1..777 17..793 3840 99.6 Plus
eIF-4E-RH 780 CG4035-PH 1..777 17..793 3840 99.6 Plus
eIF-4E-RD 780 CG4035-PD 1..777 17..793 3840 99.6 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:52:29
Subject Length Description Subject Range Query Range Score Percent Strand
eIF-4E-RI 1793 CG4035-RI 760..1538 15..793 3850 99.6 Plus
eIF-4E-RH 1492 CG4035-RH 459..1237 15..793 3850 99.6 Plus
eIF-4E-RD 1723 CG4035-RD 690..1468 15..793 3850 99.6 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 16:52:25
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 9400583..9400953 444..74 1855 100 Minus
3L 28110227 3L 9399873..9400033 793..633 790 99.4 Minus
3L 28110227 3L 9400419..9400519 544..444 490 99 Minus
3L 28110227 3L 9400097..9400185 632..544 430 98.9 Minus
X 23542271 X 1158961..1159338 651..274 375 73.3 Minus
3R 32079331 3R 29026520..29026848 642..314 355 73.9 Minus
3L 28110227 3L 9401040..9401098 73..15 295 100 Minus
3L 28110227 3L 6665168..6665336 443..275 290 78.1 Minus
Blast to na_te.dros performed on 2014-11-26 16:52:26 has no hits.

BO28567.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-07-13 10:17:13 Download gff for BO28567.complete
Subject Subject Range Query Range Percent Splice Strand
eIF-4E-RE 489..1274 17..801 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 02:11:58 Download gff for BO28567.complete
Subject Subject Range Query Range Percent Splice Strand
eIF-4E-RD 692..1477 17..801 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 17:29:27 Download gff for BO28567.complete
Subject Subject Range Query Range Percent Splice Strand
eIF-4E-RD 692..1477 17..801 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 17:29:27 Download gff for BO28567.complete
Subject Subject Range Query Range Percent Splice Strand
3L 9401040..9401096 17..73 100   Minus
3L 9400583..9400953 74..444 100 <- Minus
3L 9400419..9400518 445..544 99 <- Minus
3L 9400097..9400184 545..632 98 <- Minus
3L 9399864..9400033 633..801 97 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 02:11:58 Download gff for BO28567.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 9394140..9394196 17..73 100   Minus
arm_3L 9393683..9394053 74..444 100 <- Minus
arm_3L 9393519..9393618 445..544 99 <- Minus
arm_3L 9393197..9393284 545..632 98 <- Minus
arm_3L 9392964..9393133 633..801 97 <- Minus

BO28567.pep Sequence

Translation from 16 to 817

> BO28567.pep
MQSDFHRMKNFANPKSMFKTSAPSTEQGRPEPPTSAAAPAEAKDVKPKED
PQETGEPAGNTATTTAPAGDDAVRTEHLYKHPLMNVWTLWYLENDRSKSW
EDMQNEITSFDTVEDFWSLYNHIKPPSEIKLGSDYSLFKKNIRPMWEDAA
NKQGGRWVITLNKSSKTDLDNLWLDVLLCLIGEAFDHSDQICGAVINIRG
KSNKISIWTADGNNEEAALEIGHKLRDALRLGRNNSLQYQLHKDTMVKQG
SNVKSIYTLGKLPDHSF

BO28567.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 06:56:14
Subject Length Description Subject Range Query Range Score Percent Strand
eIF-4E-PI 259 CG4035-PI 1..259 1..259 1387 100 Plus
eIF-4E-PH 259 CG4035-PH 1..259 1..259 1387 100 Plus
eIF-4E-PD 259 CG4035-PD 1..259 1..259 1387 100 Plus
eIF-4E-PB 259 CG4035-PB 1..259 1..259 1387 100 Plus
eIF-4E-PF 259 CG4035-PF 1..259 1..259 1387 100 Plus