Clone BO28569 Report

Search the DGRC for BO28569

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:285
Well:69
Vector:pDNR-Dual
Associated Gene/TranscriptCG31534-RB
Protein status:BO28569.pep: Imported from assembly
Sequenced Size:2581

Clone Sequence Records

BO28569.complete Sequence

2581 bp assembled on 2011-08-04

GenBank Submission: KX794108

> BO28569.complete
GAAGTTATCAGTCGACATGGACAAGGCACAACATCCACAGAAGCGGGAAC
AGAAGGAGGAGCTGGGAGGTAAGCCGGAGGAGAAGGAGCCAATTTGCGAG
GAGCAGCACGACGAAGAGTCCAACGAGCAGGGGGAAACACACAACGAGGG
TGGGGAAATGCCAAATAAAACCGATAAGCAAATGCAGGGGGGACGAGAGC
CCATCTATGAGAATGTCAGCTCGACTATATCTATGCATGAAGTAGATAAT
GAACAGATAGCAACTATGACGATAACCACACAGACCCAAGCGACGCGAAT
AAGTCACAGGAGAAGCATTCCAAGCCAGCAAACCAGCAACAGTAACGAGA
ATAATCAAAGCACTAATCAAACCAGCAACAGCAGGAATCAAAAAGAGAGC
AGCACAGCAGCAACATCGGCAGCGAACCCCGTGCCACCAACAACACCGGG
GGAACAAGCAGAGCCCTACTACCAAGTGCCGAAGGCCACGGAGCCCTACT
ACGATGCCCCCAAGCATTTAAGGCCGGTGCCGGTATACGAAAATGTCGAG
ATCTTTTACTCGGGCCTGGAGATTAGTCAGGGATCTGTGGGAGCGCCAGT
AGGGCTGATGGAGCCACCCAAGGAAAAGCCACCACCACCGCCCACCGAGA
GTCCGATTCCGCTGGACGAGGGCCATGACGACGAGCTGGATGGACTGGGC
AACAGTCTGGGCCACAACACAGACACCTGGTCATCGGACAACACCTACGA
GACCATATCGAACGGCACTCGCCGGCACCTTCAGGGACAACCGGAACCCG
CCCAACCCTCGCCGCCCATCAAGAGGATGAACTCGACCAAACGGATCAAG
AAGGAGTTGCGCAACAAGCGCTCCAGCTTCCTGGGCATCGAAAACGACGG
CGATCTTGACGACATGGAGACCTATCTCGAGCTAACAGTGGCCCCGCCTC
CGGATATGGCGCAGCTCTTGCAGGAGGAGCGGCGACTGGAGAAGCAGCTG
TACATCAAGGCGGGACTCTGCGACAGTTCCGACACAGGTGAAAGCCGCGA
TTCTGGAGTTTCTGAAAACCACTCTCGCCAGAGCAGTGAGCACTACACGA
ACTCCTCTGAGGAGAACGATACACAGTCAGAGGCCACACCGCCGCCATTG
CCTCCACCACCATCGACCGCCCAAGTGGGTGAAGTCATATACCAAAATGA
GAGCCTCCTGGCTGCCCAGACGCCGCTTCTCCAGACGGTAAAAGGAAACT
CCGCCGAGTCCTGGACCGAATCAGCAACGGCCGCAGCGGCGGCCACGCAA
TCATTGAGCGAAGCCACAGCAACGGCCAATGCCAAGATGCAGTCCATCGA
GGATAAGATCCGGGAGCAGGGAGAGATGTTGCGGGTGGAACGCGAGCTAC
TGCACTTCTCGCAAGAGGAACTGAAACGGCAACGTGAAAATCTTGTGCTT
CGAGAAAATATTGCTCGACGAGAGTTGCAACACGGAGCCAAGATGCTGAT
GTCGAACAACCGGCGCTCACTGCAGGATCTGCACCACGGTCTAGGAATCG
GAAACGGAATGCTCAGTGCCTTCCAGCCACCGCAACACCACCAGGTTCAA
ATGCCACCACCGCATCCGCAACAGATTTACGCCAATGTGCCGCAGCAGCA
GCAACAGATGGTTCTGCATGCATATCACCAGATGGACACGGACTACCGCA
AGTCCATGTCGGATCTAAACGAGTTCTCCAACTGCCTGATACTGCCGCCA
ACGCCGCCCACAAAGCCATTGAGGGCTATGCAATTGAACGCCAATGGCCA
TGGCCTGGAGCCAGATTACGCTGTTAGCACGAGGCAGCGCCAACCACCGG
CTCCGTACGGTGGCTCTCTGGTAAAGATTGCTGGAGCACCAATGCCGCCA
CGGCTCCCCGGTCAAGGATATCCCATTCAAGCGCCGACAGCGCCAGCATA
CCATCACCAGTCGGCCCAAAACTTAAGCAATATGTCCAGAAACACATTGC
TCGCTTTGAGTGCCACCCCCAAACCAAAATACGCGGACGGATGGGTGCAG
GTGCAGCAGCGGAAGAGTTATGACAGCCAACAGACCAGCGATGCGGCTTG
GCTGGCCGCTCAGCAGCAAAAGCGCAAATCCATGCCTGACTACGGCGGAG
CACTCTACAATAACAACCACTGGCTACTGCAGGAGGCGGAGCAGCGACGC
ATCGAGCAACTTAATCGGCGATCTATACCAGCCAGCAAGTCGATGGGCAA
ACCGCTGCCCGATTCCATCATACAAACTCTTACGGAGCGGGTCCAGAGCA
AAGGAATCGGCGATCGAAAGCGCTTCGATAGCAACGGGAACTATAGCCAG
GTAAATGGCAACAACATCTACCAGCAGCAACAGCAGCAGAAGAATGTGAC
GAATGGCAGCAGCATCAATGGCAACAGCAGCCAGGGGCAGGAGAAGGTGC
TCAGCGTTAGTGGCAAGAAGAAGTGCTCCCATTGCGGCGACGAATTAGAT
CTGGGCTGCACTCACGGCAATTGTCGGCAGGTGCACAAAGCGCTAAAATA
TATTGTTTGGGTGGCAAGCTTTCTAGACCAT

BO28569.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 01:00:17
Subject Length Description Subject Range Query Range Score Percent Strand
CG43427-RJ 2550 CG43427-PJ 1..2547 17..2563 12735 100 Plus
CG43427-RH 4482 CG43427-PH 1933..4479 17..2563 12735 100 Plus
CG43427-RI 2670 CG43427-PI 1..2482 17..2498 12410 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 01:00:18
Subject Length Description Subject Range Query Range Score Percent Strand
CG43427-RJ 4163 CG43427-RJ 281..2827 17..2563 12735 100 Plus
CG43427-RH 6180 CG43427-RH 2546..5092 17..2563 12735 100 Plus
CG43427-RI 3810 CG43427-RI 281..2762 17..2498 12410 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 01:00:15
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 4707086..4708108 17..1039 5115 100 Plus
3R 32079331 3R 4709159..4710070 1411..2322 4560 100 Plus
3R 32079331 3R 4708674..4709049 1036..1411 1880 100 Plus
3R 32079331 3R 4710176..4710352 2322..2498 885 100 Plus
3R 32079331 3R 4710614..4710680 2497..2563 335 100 Plus
Blast to na_te.dros performed 2014-11-27 01:00:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6740..6823 1574..1657 168 66.7 Plus
roo 9092 roo DM_ROO 9092bp 1070..1154 358..444 158 71.9 Plus
roo 9092 roo DM_ROO 9092bp 1064..1175 307..415 146 63.7 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6761..6843 1574..1656 145 63.9 Plus
roo 9092 roo DM_ROO 9092bp 1067..1149 1574..1656 127 61.4 Plus
Dbuz\Osvaldo 9045 Dbuz\Osvaldo DBU133521 9045bp Derived from AJ133521 (Rel. 60, Last updated, Version 2). 7205..7320 654..767 125 57.8 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2340..2422 1574..1656 118 60.2 Plus

BO28569.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-08-04 15:54:00 Download gff for BO28569.complete
Subject Subject Range Query Range Percent Splice Strand
CG31534-RB 281..2827 17..2565 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 04:41:42 Download gff for BO28569.complete
Subject Subject Range Query Range Percent Splice Strand
CG43427-RH 2546..5092 17..2565 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 02:16:04 Download gff for BO28569.complete
Subject Subject Range Query Range Percent Splice Strand
CG43427-RH 2546..5092 17..2565 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 02:16:04 Download gff for BO28569.complete
Subject Subject Range Query Range Percent Splice Strand
3R 4710616..4710680 2499..2565 97   Plus
3R 4710177..4710352 2323..2498 100 -> Plus
3R 4709160..4710070 1412..2322 100 -> Plus
3R 4708676..4709049 1038..1411 100 -> Plus
3R 4707086..4708106 17..1037 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 04:41:42 Download gff for BO28569.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 536338..536402 2499..2565 97   Plus
arm_3R 535899..536074 2323..2498 100 -> Plus
arm_3R 534882..535792 1412..2322 100 -> Plus
arm_3R 534398..534771 1038..1411 100 -> Plus
arm_3R 532808..533828 17..1037 100 -> Plus

BO28569.pep Sequence

Translation from 16 to 2581

> BO28569.pep
MDKAQHPQKREQKEELGGKPEEKEPICEEQHDEESNEQGETHNEGGEMPN
KTDKQMQGGREPIYENVSSTISMHEVDNEQIATMTITTQTQATRISHRRS
IPSQQTSNSNENNQSTNQTSNSRNQKESSTAATSAANPVPPTTPGEQAEP
YYQVPKATEPYYDAPKHLRPVPVYENVEIFYSGLEISQGSVGAPVGLMEP
PKEKPPPPPTESPIPLDEGHDDELDGLGNSLGHNTDTWSSDNTYETISNG
TRRHLQGQPEPAQPSPPIKRMNSTKRIKKELRNKRSSFLGIENDGDLDDM
ETYLELTVAPPPDMAQLLQEERRLEKQLYIKAGLCDSSDTGESRDSGVSE
NHSRQSSEHYTNSSEENDTQSEATPPPLPPPPSTAQVGEVIYQNESLLAA
QTPLLQTVKGNSAESWTESATAAAAATQSLSEATATANAKMQSIEDKIRE
QGEMLRVERELLHFSQEELKRQRENLVLRENIARRELQHGAKMLMSNNRR
SLQDLHHGLGIGNGMLSAFQPPQHHQVQMPPPHPQQIYANVPQQQQQMVL
HAYHQMDTDYRKSMSDLNEFSNCLILPPTPPTKPLRAMQLNANGHGLEPD
YAVSTRQRQPPAPYGGSLVKIAGAPMPPRLPGQGYPIQAPTAPAYHHQSA
QNLSNMSRNTLLALSATPKPKYADGWVQVQQRKSYDSQQTSDAAWLAAQQ
QKRKSMPDYGGALYNNNHWLLQEAEQRRIEQLNRRSIPASKSMGKPLPDS
IIQTLTERVQSKGIGDRKRFDSNGNYSQVNGNNIYQQQQQQKNVTNGSSI
NGNSSQGQEKVLSVSGKKKCSHCGDELDLGCTHGNCRQVHKALKYIVWVA
SFLDH

BO28569.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 07:12:54
Subject Length Description Subject Range Query Range Score Percent Strand
CG43427-PJ 849 CG43427-PJ 1..849 1..849 4475 100 Plus
CG43427-PH 1493 CG43427-PH 645..1493 1..849 4475 100 Plus
CG43427-PP 1501 CG43427-PP 645..1501 1..849 4449 98.9 Plus
CG43427-PO 1541 CG43427-PO 645..1481 1..837 4359 99.2 Plus
CG43427-PI 889 CG43427-PI 1..830 1..830 4349 99.8 Plus