Clone BO28570 Report

Search the DGRC for BO28570

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:285
Well:70
Vector:pDNR-Dual
Associated Gene/Transcriptbgm-RA
Protein status:BO28570.pep: Imported from assembly
Sequenced Size:2032

Clone Sequence Records

BO28570.complete Sequence

2032 bp assembled on 2011-08-04

GenBank Submission: KX795836

> BO28570.complete
GAAGTTATCAGTCGACATGTCCACGATAGACGCGCTCTACAATCGTCCTG
GGCCCAACCGCCTGCGGCAGGCGGATGCCTATCGCACCACCAATCGTCAG
GATGCCGTCAAGATTCGTATGGCCAAGGATGGAATCGGCGCAGAGGAGCC
CATCTCCGTGCCCGGCCTGCTGAAGCGTACGGTCAACAATTACGGCGACT
ATCCTGCGCTGCGCACCAAGAACGGCAAAAACGGATATCACACTGTCACC
TACAAACAATATGAGCAGAAGGTGCACCAGGTGGCCAAGGCGTTCATTAA
GCTCGGTCTGGAGGAGCACCATTCGGTGGGTGTGCTGGCCTTCAATTGCG
CCGAATGGTTCTACTCGGCCATGGGCGCCATTCACGCACGAGGCATCATC
GCCGGAATCTACACCACCAATTCCGCCGATGCAGTGCAGCACGTTCTGGA
GAGCTCACATGCCCAAATCGTGGTCGTCGACGACGCCAAGCAAATGGACA
AGATTCACGCCATTCGCGACAAGCTGCCCAAGCTCAAGGCCGCCATTCAG
ATCCAGGAGCCCTATTCCCCCTACTTGAAGAAGGAGGATGGCTACTACAG
GTGGTCGGAGATCGAGTCGATGAACGTTAGCGACGTGGAGGATCAGTACA
TGACCCGTTTGGAGAATGTGGCGATCAACGAGTGCTGCTGCCTGGTCTAC
ACCTCCGGAACGGTGGGCATGCCCAAGGGCGTGATGCTCTCCCACGACAA
CATCACCTTCGATGTGCGCGGCATCGTCAAGGCCATGGACCGTGTGGTGG
TTGGGGCGGAGTCGATCGTCTCCTACCTGCCACTTTCGCACGTGGCCGCC
CAGACCGTGGACATTTACACCTGCGCCTTTGTGGCGGGCTGCATTTGGTT
CGCCGACAAGGATGCGCTGAAGGGAACGCTGGTGAAGTCGCTGCAGGATG
CGCGACCCACGCGATTCATGGGCGTGCCGCGTGTGTACGAGAAGTTCCAG
GAGCGAATGGTCGCCGTGGCCAGTTCCAGCGGCAGCCTGAAGAAGATGCT
CGCCAGCTGGGCCAAGGGCATCACGCTGAAGCACTACATGGTGAGTCAAG
GCAAGAGCTCCGGGGGATTCCGGTACAAGATTGCCAAGTCGCTCATCATG
TCCAAGGTGAAGCAGGCCCTGGGCTTCGATCGCGTCCTTACACTGGCCAG
TGCGGCAGCTCCCATGTCGCCGGAGACGAAGAAGTACTTCCTCAGTCTGG
ACCTGAAGATTGTCGATGCCTTCGGCATGTCGGAGACGGCCGGTTGCCAC
ACCATCTGCCTTCCCGATTCTGTGGGCCTGAACACAATTGGCAAAACTTT
GCCCGGCTGCGAGTCCAAGTTCATCAACAAGGATGCCAACGGTCACGGAG
AGCTGTGCATCCGAGGACGTCATGTTTTCATGGGCTACATCGACAACAAG
GAGAAGACCGAGGAGTCGCTGGATGACGACTGCTGGCTGCATTCCGGTGA
TTTGGGATTTGTTGATGACAAGGGTTATGTTTCACTGACGGGACGATCCA
AGGAGATCATCATTACCGCCGGCGGCGAGAACATTCCGCCAGTGCACATC
GAGAACACGATCAAGAAGGAGTTGGATGCCATTTCCAATGCCTTTTTGGT
GGGCGAGCAGCGCAAATATCTCACTGTTCTGATCACCCTTAAGACCGAAG
TGGACAAGGATTCCGGTGAGCCGCTGGACGAGCTTAGCCACGAGTCCTCC
GTGTGGGTGAAATCGCTGGGAGTGGAGCACAAGACCGTATCGGATATCCT
GGCCGCAGGTCCCTGCCCCAAGGTGTGGAAGTCCATCGAGGATGCCATCA
AGCGGGCCAACAAGCAGTCCATTTCCAATGCCCAAAAGGTTCAGAAGTTC
ACCATTCTGCCGCACGACTTCTCCATTCCCACCGGCGAACTTGGACCCAC
CCTAAAGGTTAAGCGCAACGTTGTGTCCAAGATGTATGCCGATGAGATCG
AGAAACTATATGCCGCAAGCTTTCTAGACCAT

BO28570.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 00:58:44
Subject Length Description Subject Range Query Range Score Percent Strand
bgm-RC 2001 CG4501-PC 1..1998 17..2014 9735 99.1 Plus
bgm-RA 2001 CG4501-PA 1..1998 17..2014 9735 99.1 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 00:58:45
Subject Length Description Subject Range Query Range Score Percent Strand
bgm-RC 2464 CG4501-RC 143..2142 15..2014 9745 99.2 Plus
bgm-RA 2501 CG4501-RA 180..2179 15..2014 9745 99.2 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 00:58:42
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 14018034..14018626 1101..1693 2785 98 Plus
2L 23513712 2L 14016537..14017037 601..1101 2475 99.6 Plus
2L 23513712 2L 14016132..14016477 256..601 1730 100 Plus
2L 23513712 2L 14018684..14019006 1692..2014 1600 99.7 Plus
2L 23513712 2L 14015794..14016034 15..255 1175 99.2 Plus
Blast to na_te.dros performed on 2014-11-27 00:58:43 has no hits.

BO28570.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-08-04 15:53:58 Download gff for BO28570.complete
Subject Subject Range Query Range Percent Splice Strand
bgm-RA 180..2177 17..2016 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 04:40:42 Download gff for BO28570.complete
Subject Subject Range Query Range Percent Splice Strand
bgm-RA 182..2179 17..2016 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 02:15:17 Download gff for BO28570.complete
Subject Subject Range Query Range Percent Splice Strand
bgm-RA 182..2179 17..2016 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 02:15:17 Download gff for BO28570.complete
Subject Subject Range Query Range Percent Splice Strand
2L 14018686..14019006 1694..2016 99   Plus
2L 14018035..14018626 1102..1693 97 -> Plus
2L 14016538..14017037 602..1101 99 -> Plus
2L 14016132..14016477 256..601 100 -> Plus
2L 14015796..14016034 17..255 99 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 04:40:42 Download gff for BO28570.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 14018686..14019006 1694..2016 99   Plus
arm_2L 14018035..14018626 1102..1693 97 -> Plus
arm_2L 14016538..14017037 602..1101 99 -> Plus
arm_2L 14016132..14016477 256..601 100 -> Plus
arm_2L 14015796..14016034 17..255 99 -> Plus

BO28570.pep Sequence

Translation from 16 to 2032

> BO28570.pep
MSTIDALYNRPGPNRLRQADAYRTTNRQDAVKIRMAKDGIGAEEPISVPG
LLKRTVNNYGDYPALRTKNGKNGYHTVTYKQYEQKVHQVAKAFIKLGLEE
HHSVGVLAFNCAEWFYSAMGAIHARGIIAGIYTTNSADAVQHVLESSHAQ
IVVVDDAKQMDKIHAIRDKLPKLKAAIQIQEPYSPYLKKEDGYYRWSEIE
SMNVSDVEDQYMTRLENVAINECCCLVYTSGTVGMPKGVMLSHDNITFDV
RGIVKAMDRVVVGAESIVSYLPLSHVAAQTVDIYTCAFVAGCIWFADKDA
LKGTLVKSLQDARPTRFMGVPRVYEKFQERMVAVASSSGSLKKMLASWAK
GITLKHYMVSQGKSSGGFRYKIAKSLIMSKVKQALGFDRVLTLASAAAPM
SPETKKYFLSLDLKIVDAFGMSETAGCHTICLPDSVGLNTIGKTLPGCES
KFINKDANGHGELCIRGRHVFMGYIDNKEKTEESLDDDCWLHSGDLGFVD
DKGYVSLTGRSKEIIITAGGENIPPVHIENTIKKELDAISNAFLVGEQRK
YLTVLITLKTEVDKDSGEPLDELSHESSVWVKSLGVEHKTVSDILAAGPC
PKVWKSIEDAIKRANKQSISNAQKVQKFTILPHDFSIPTGELGPTLKVKR
NVVSKMYADEIEKLYAASFLDH

BO28570.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 07:12:45
Subject Length Description Subject Range Query Range Score Percent Strand
bgm-PC 666 CG4501-PC 1..666 1..666 3452 100 Plus
bgm-PA 666 CG4501-PA 1..666 1..666 3452 100 Plus
CG4500-PA 681 CG4500-PA 2..680 14..665 1522 44.2 Plus
CG3961-PD 654 CG3961-PD 81..650 74..665 420 23.8 Plus
CG3961-PE 666 CG3961-PE 93..662 74..665 420 23.8 Plus