Clone BO28572 Report

Search the DGRC for BO28572

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:285
Well:72
Vector:pDNR-Dual
Associated Gene/TranscriptCG9801-RA
Protein status:BO28572.pep: Imported from assembly
Sequenced Size:2161

Clone Sequence Records

BO28572.complete Sequence

2161 bp assembled on 2011-08-04

GenBank Submission: KX799774

> BO28572.complete
GAAGTTATCAGTCGACATGCCGTCGCTGCGCCAGAAAGTCACCACTTACT
TCCGCCAGTTGAGCTTCATCGCGGAGCCTCGCGAGGGTCGCCGGCGGGCC
AGCGAGCACGAGGATGATGATGGTAGCTTCATAACTAAATATCTGGAGGG
CCGAATGCAGCGTCAGTTTGTTGAGGGTCCGGAGATTTACAATGGCCAGA
ATCCCACGGACATGCCCGTTCTCAAGTTGGATACATACGAAGCTGGAAAC
TGCTCTATAACAGCCGCCTGCACAGGTCCTGACGAGGGGCTCACCGGCAT
CAAGCGCTCCAAACTGCACTTGAGCACCAGCTTCGCGGATGACATTGACT
TCATAGATACGCAGCAGGAGAACGATGATTGCTATGGCGTTAGGAGGAGT
ACACCACCAGTTCAGGTGGCCACACAGAACTCAACCCGACTTACCAGCAA
ATTCGGACGGCCGCCGGCAGGACCTCGCAGACAGAGCAGTGCGGAGCAGC
CCTCCGGATCTGCTTCTGCGTCGGGAATGCGTTCCCGCAAGAATTCCAAA
AGCAGCATAGCCAATCTGGCCGCTGCGTCTGCTGGCACGGATGCTGGAAA
AGCCAACAGCGATCAGAACAATAGGAATGTGTTAAATGCAAAGACTGAGG
TCTCGACGGATGGGGATCCCAACTCAGAGCGGGAACGTTTGCTCCGCGAA
GCTGTAAGCAACCAGGGTGGCTCTGATCCCGCAGCTTTGATCGCTGGCGT
GGAGAACTGGCGCATGGAGTGCGACTTCGCATATGGTATCTCGGTGTCCC
TCTACGAGACCAACATGCTGACTAAAGAACCCATGGGCAATCCCATCGCC
GACTGCTACGGAATGGTAGTGCGCGGAGACTCAGCTGCCATGGCCATGGC
AGATGGTGTCAACTGGGGTGATGGCGCTCGTCTGGCCGCCCGTTCAGCTG
TTCACGGTTGTTTGGACTATCTGGACCGGGCGGTCTTCGGACAGGCGCTG
GAGTGCCGAGCCACCACAACCCAGGAGGTTTTTGTGAGTTTGCTGCGTAG
TCTTTGGGAGGGACACGGTTGTATCCTGGAAGTTGGAGGAGCCCTATCTA
CTCTCACCATAGCCGTTGTGCTGCCGCTGGACGGAGCGCCAGGGAAATAT
GTCGTGTGCTCGTGTAATGTTGGCGATTCCCTGGGCTATGTGTACTCCAA
GAAGCACGGAGTACGGGAACTAACACAGGCATCCCACGACATCAGTTCCA
TGAGGGACATGCGCGATGCGTTGGGTGCCCTTGGACCGGCGGATGGCAAC
AAGCCAGAGCTGAGCAATCTAACCTTCTCGATGACCTGCATTGAAAGTGG
AGACATAGTCTTTTTAACGTCGGATGGAATCAGCGATAACTTCGATCCAG
TTGTGGGCAAGTTTGCCGAAGCCTGGACTCCGGATGTTAAGCTTCAGACG
TCGGGACATGTCAAGCCCGCCAACTTGGCACCCAAACGGCAGAACAAGAG
TGCATCCGCCATCTATGCCCGTCTGCATCCTTCGACTCCGCCCACGCGAC
CAGCTCGTCAGTCCAAGGCGGAAAGTCCGCCTAATAATGCGCCTAGTCGA
CCAAAGTATATGCGCTCCCAAACGCTTATTGAACCACGCCAGGGATTGGT
ATCAGCTCCACCGCCATCGGTGGTGCCCCAACGCATTCCGAAGTCCATTT
CAGGACTGCCCCTTGTTACCGGTCCCCAGCGGCATGCTCTTACCCTCTAC
CGCTTAGAGGATCTGCTCAGCTATGGCATCAACGGCACGTTTTCGCCCTG
CGTATCGGCACGCAGGCTCTGCCACTTGCTTATCGATTTTGTACGGATGA
TAACGTCAGCCAGGAGGAAGACCCTGGAGCAAAGGGAACTCTTCTATAAA
CTCTCTACGGGACCAGATGGCGCCAAGCGTGAGGTGCAACTGAACCGCAT
GCAGCATCGCGCGGCCAGGAAGCGTGTGGTGGACAGCAGCGCCTTTGTAG
CATTGCCCGGGAAATTGGATCATGCCACTGTGATGGCCTACACGGTGGGC
GGCGGAGAGGAGCACAATAATGGAAATGAAAACGGCGATGGGGGAGCTAT
TTCGCCTGTACTGCAATCCAAGGAGTTCAAGGAGACGAATTTCGCAAGCT
TTCTAGACCAT

BO28572.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 01:06:49
Subject Length Description Subject Range Query Range Score Percent Strand
CG9801-RC 2130 CG9801-PC 1..2127 17..2143 10635 100 Plus
CG9801-RB 2130 CG9801-PB 1..2127 17..2143 10635 100 Plus
CG9801-RA 2130 CG9801-PA 1..2127 17..2143 10635 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 01:06:51
Subject Length Description Subject Range Query Range Score Percent Strand
CG9801-RC 3294 CG9801-RC 331..2457 17..2143 10635 100 Plus
CG9801-RB 3327 CG9801-RB 364..2490 17..2143 10635 100 Plus
CG9801-RA 3476 CG9801-RA 513..2639 17..2143 10635 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 01:06:47
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 8736716..8738709 2143..150 9970 100 Minus
3R 32079331 3R 8738778..8738911 150..17 670 100 Minus
Blast to na_te.dros performed on 2014-11-27 01:06:48 has no hits.

BO28572.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-08-04 17:43:40 Download gff for BO28572.complete
Subject Subject Range Query Range Percent Splice Strand
CG9801-RC 306..2432 17..2145 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 04:45:21 Download gff for BO28572.complete
Subject Subject Range Query Range Percent Splice Strand
CG9801-RA 513..2639 17..2145 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 02:18:47 Download gff for BO28572.complete
Subject Subject Range Query Range Percent Splice Strand
CG9801-RA 513..2639 17..2145 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 02:18:47 Download gff for BO28572.complete
Subject Subject Range Query Range Percent Splice Strand
3R 8738778..8738911 17..150 100   Minus
3R 8736713..8738708 151..2145 99 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 04:45:21 Download gff for BO28572.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 4564500..4564633 17..150 100   Minus
arm_3R 4562435..4564430 151..2145 99 <- Minus

BO28572.pep Sequence

Translation from 16 to 2161

> BO28572.pep
MPSLRQKVTTYFRQLSFIAEPREGRRRASEHEDDDGSFITKYLEGRMQRQ
FVEGPEIYNGQNPTDMPVLKLDTYEAGNCSITAACTGPDEGLTGIKRSKL
HLSTSFADDIDFIDTQQENDDCYGVRRSTPPVQVATQNSTRLTSKFGRPP
AGPRRQSSAEQPSGSASASGMRSRKNSKSSIANLAAASAGTDAGKANSDQ
NNRNVLNAKTEVSTDGDPNSERERLLREAVSNQGGSDPAALIAGVENWRM
ECDFAYGISVSLYETNMLTKEPMGNPIADCYGMVVRGDSAAMAMADGVNW
GDGARLAARSAVHGCLDYLDRAVFGQALECRATTTQEVFVSLLRSLWEGH
GCILEVGGALSTLTIAVVLPLDGAPGKYVVCSCNVGDSLGYVYSKKHGVR
ELTQASHDISSMRDMRDALGALGPADGNKPELSNLTFSMTCIESGDIVFL
TSDGISDNFDPVVGKFAEAWTPDVKLQTSGHVKPANLAPKRQNKSASAIY
ARLHPSTPPTRPARQSKAESPPNNAPSRPKYMRSQTLIEPRQGLVSAPPP
SVVPQRIPKSISGLPLVTGPQRHALTLYRLEDLLSYGINGTFSPCVSARR
LCHLLIDFVRMITSARRKTLEQRELFYKLSTGPDGAKREVQLNRMQHRAA
RKRVVDSSAFVALPGKLDHATVMAYTVGGGEEHNNGNENGDGGAISPVLQ
SKEFKETNFASFLDH

BO28572.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 07:14:03
Subject Length Description Subject Range Query Range Score Percent Strand
CG9801-PC 709 CG9801-PC 1..709 1..709 3681 100 Plus
CG9801-PB 709 CG9801-PB 1..709 1..709 3681 100 Plus
CG9801-PA 709 CG9801-PA 1..709 1..709 3681 100 Plus