Clone BO28575 Report

Search the DGRC for BO28575

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:285
Well:75
Vector:pDNR-Dual
Associated Gene/TranscriptEs2-RA
Protein status:BO28575.pep: Imported from assembly
Sequenced Size:1537

Clone Sequence Records

BO28575.complete Sequence

1537 bp assembled on 2011-07-13

GenBank Submission: KX798130

> BO28575.complete
GAAGTTATCAGTCGACATGAGCGCCACGACTAGAACACCTGCCACACCGG
GGACACCTGGCACTCCCGGCAGCCTGGCCATGGAAGTGGCCCGCGTCCAG
AATTCAGCACTCGCCGAGTTTAAAAAGCCCACGGCGATGGTGCGCCACAA
GAACAAGCCAAAGATCCTTACCGAGGAGAAGTACATCGAGGAGATGTCTA
AGATCATCCAGCGCGACTTCTTTCCCGATCTGGAGCGGCTGCGTGCCCAA
AACGACTACCTGGACGCGGAGTCACGGCGCGACTTTGTACAAATGGCCGA
GATTCGGGAGCGCTACAGTCTGGGCAGGATTTCCGGGACAGGAAGAAGCA
CCAGCCGACGGAATAATGCCATGTCCCCGGCCACATTTGAGACACCAGTG
AGTCAGGCGAAATGTAGCAACACCCCATTGCCAAATTCCCGGGCCACAGA
CACACCATTTTCCACGGACGGCTCCGAGAAGAGCGATGCCGAGGGCAGGG
ACACCACCGCGAAGCTATCGCTGGACGCCTTTCTGCAGAAGTACACCAGC
GAGGATAACCAGAGCTTTCAGGAGATCATCGAAACGGCCGAGGCCAAGCT
GCGCCAAAAATACGCAGTACTGTACAACCATGAGAAGCTCTCCGCAGAGC
AACTGCAGCGGGCCCTAATGCTGCCCAGCATAGAAACGCAATTCGAGGAG
CCAGATCCGCTGAGAAAGATCGAAACCTGGAACTACACCAACATGAATTC
CATTATGTACGTGCCCGATGGCGTGGAGTACACAGAGGAGGAGCGCGTCC
AGTTGGCCGAACGGAAGCAGAGCATCCAACACAATGCCACCAGGCTGCCC
GATGAGGCAAAGCATCGCGAAATGGACACTAAAAAGCTGAATGATGAAGT
GCCCCAAAATGGGGCTGGTGGTGCCACAGCTACTCCGAAGGTACGCGGCT
TCGATTTGTTGCGTTCACCATCACCGCGACCCGGAGAGGCTTTCTCGCCC
ATAATGACCTGGGGTGAGATCGATGGCACTCCCTTTCGCCTGGACGGAGG
CGATACCCCATTGCGGCCCACACAAGGACCCTCGTTCCGGATTAATGAGA
ACTCTCGGCGCGAAAACATCGCCATCGCTTTGGCCGAAAGGGTCAGCGAA
AGGATGCGAAATCAAAAACAAATGGCTCTGGATACGGCGCGTCGTAACAT
TGGCTCACCACTGATACGCACCAATATGGAACGGCTGGCCAGCATGTCGC
CGGCAGCGCAGCTACTGGCCACGGGTAAGCTGGGTATCCGCGGCACGCCC
CGATTAAGGCACACACCATCGCCGATGAGCGGCAGAAAACGAAAGGTTAC
GCCCGGCGTGGTGAGGAGCACCAATACGCCAATACTGGGTGAACCCAAAC
CCAAACAGCAGGCCAAGATTAGCACTCCGGCTAAGAACGTTACCATTGAT
ACGGGATCCACGCTCACGGACGATCTGCTCAAGATACCCACTAAACGACG
CACTGCAGCCGATTTCTTTGCAAGCTTTCTAGACCAT

BO28575.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 16:59:53
Subject Length Description Subject Range Query Range Score Percent Strand
Es2-RA 1506 CG1474-PA 1..1503 17..1519 7515 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:59:54
Subject Length Description Subject Range Query Range Score Percent Strand
Es2-RA 1729 CG1474-RA 93..1595 17..1519 7515 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 16:59:51
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 8462064..8463215 368..1519 5760 100 Plus
X 23542271 X 8461571..8461922 17..368 1760 100 Plus
Blast to na_te.dros performed on 2014-11-26 16:59:52 has no hits.

BO28575.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-07-13 12:52:54 Download gff for BO28575.complete
Subject Subject Range Query Range Percent Splice Strand
Es2-RA 96..1598 17..1521 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 02:15:18 Download gff for BO28575.complete
Subject Subject Range Query Range Percent Splice Strand
Es2-RA 93..1595 17..1521 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 17:32:43 Download gff for BO28575.complete
Subject Subject Range Query Range Percent Splice Strand
Es2-RA 93..1595 17..1521 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 17:32:43 Download gff for BO28575.complete
Subject Subject Range Query Range Percent Splice Strand
X 8462065..8463215 369..1521 99   Plus
X 8461571..8461922 17..368 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 02:15:18 Download gff for BO28575.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 8356098..8357248 369..1521 99   Plus
arm_X 8355604..8355955 17..368 100 -> Plus

BO28575.pep Sequence

Translation from 16 to 1537

> BO28575.pep
MSATTRTPATPGTPGTPGSLAMEVARVQNSALAEFKKPTAMVRHKNKPKI
LTEEKYIEEMSKIIQRDFFPDLERLRAQNDYLDAESRRDFVQMAEIRERY
SLGRISGTGRSTSRRNNAMSPATFETPVSQAKCSNTPLPNSRATDTPFST
DGSEKSDAEGRDTTAKLSLDAFLQKYTSEDNQSFQEIIETAEAKLRQKYA
VLYNHEKLSAEQLQRALMLPSIETQFEEPDPLRKIETWNYTNMNSIMYVP
DGVEYTEEERVQLAERKQSIQHNATRLPDEAKHREMDTKKLNDEVPQNGA
GGATATPKVRGFDLLRSPSPRPGEAFSPIMTWGEIDGTPFRLDGGDTPLR
PTQGPSFRINENSRRENIAIALAERVSERMRNQKQMALDTARRNIGSPLI
RTNMERLASMSPAAQLLATGKLGIRGTPRLRHTPSPMSGRKRKVTPGVVR
STNTPILGEPKPKQQAKISTPAKNVTIDTGSTLTDDLLKIPTKRRTAADF
FASFLDH

BO28575.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 06:57:08
Subject Length Description Subject Range Query Range Score Percent Strand
Es2-PA 501 CG1474-PA 1..501 1..501 2564 100 Plus