Clone BO28578 Report

Search the DGRC for BO28578

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:285
Well:78
Vector:pDNR-Dual
Associated Gene/Transcriptbam-RA
Protein status:BO28578.pep: Imported from assembly
Sequenced Size:1360

Clone Sequence Records

BO28578.complete Sequence

1360 bp assembled on 2011-07-13

GenBank Submission: KX799078

> BO28578.complete
GAAGTTATCAGTCGACATGCTTAATGCGCGTGACGTGTGTCCTGAGGGCA
ACGACGACCAGCAGTTGGACCACAATTTTAAGCAGATGGAGGAGCATTTG
GCCTTAATGGTGGAAGGCAATGAAAACGAAGATCCGAGGAAAGCCACTTG
TGAGTACGAGGATACGAACGAAGATGGTGCAACCTGCACATCGGGCGTTT
TATCCGAAATCCAGGAGAACTTCGGTAGACTCCGGTTGTGTGACGTTACT
GCACCACTCCTCGAATTCCACGGTTTGGATTGCTTGCAACAGATTCAAAA
GCGCTCGCGCCATTTTGCATTCGACGGTTCTCCGGCCAAGAAGTCGCGAT
CCGGAGGCGTGTTGGTCACCGGGCCAAAGCAGAAGCAACTGCAGAAGGAA
AATGTGTGGAACCGGAAGAGTAAAGGCTCTGCGTCCGCGGATAATATTGA
GAAACTGCCCATAACTATTGAGAAACTGCATATGATTGGTCTGCACGGCG
ATTGCTTAGAGCACAACGCCGTGCTGCGTTTGATGAATCTGTTCAGATCC
CTGCATGATCACCTGACCGCCGATTTGGGCTTCTCGCGCCAAAACTCAAT
GCCCTCGGACTATCTGTTCGATATGCCGGTGAAGAGCACGATGCCTAAGA
GCTTGAATGTGCGCTACCAACTGCAGGTGCTGTGCACCAAAGTAGAGCGC
TTCCTTGTCCAGCAGCGCCGCACCTTGGAGGCGAATCGCCACTTCGATTT
CGAGAAATACGACGAGTGTGACAAGTTGCTTAAGGGTTTCGCATCCTATT
TGGACAACTTCAAACTGCTTTTAAAGCCCAAAATGCGCAATCGAAACGGA
AACTCGGGGAGCAATGCGGACAAGTTCCATACTCAGCGCATGGAGAGATT
GCTAATTGGTCTGCGCGATTGGATCAAGGCTGCGCATCTCAGTGTGCACG
TATTTAACTGGGAAATGGATCTGGAGCACCGCTACTCCGGGGCCATGACC
GAAAGCCACAAGTCGTTGAACGAGCGGGCCATCCTTTTGTCCGGTGCCGA
GCTAAGGGCGGCCGAAGCGCGTGGAATCAGTGCGGAGGATCTGTTCATCG
CCCAGAGATACAAACTGGGAGGTCCGATCTATTGCGTTCTGGAGCAGCAT
GAGTTCCTCTCCGCTCTGATCGCCAATCCAGAGACCTATTTCCCGCCCAG
TGTTGTCGCCATTTGCGGGCCACAGAAGCTTGGCGCAGTGAGCATGGAGC
AGCCGTCAGCGTCGGAGGAGGAGTTTGAGGAGACCGAGGAAGTGCCATCA
TCGCCACCTCGTCACACCGGACGTGTACCTCGCTTCAGAAGCGCAAGCTT
TCTAGACCAT

BO28578.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 16:52:49
Subject Length Description Subject Range Query Range Score Percent Strand
bam-RA 1329 CG10422-PA 1..1326 17..1342 6615 99.9 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:52:50
Subject Length Description Subject Range Query Range Score Percent Strand
bam-RA 1894 CG10422-RA 82..1407 17..1342 6615 99.9 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 16:52:47
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 25244489..25244976 504..17 2425 99.8 Minus
3R 32079331 3R 25243526..25243992 1342..876 2335 100 Minus
3R 32079331 3R 25244054..25244425 875..504 1860 100 Minus
Blast to na_te.dros performed on 2014-11-26 16:52:48 has no hits.

BO28578.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-07-13 10:17:14 Download gff for BO28578.complete
Subject Subject Range Query Range Percent Splice Strand
bam-RA 187..1512 17..1344 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 02:12:05 Download gff for BO28578.complete
Subject Subject Range Query Range Percent Splice Strand
bam-RA 82..1407 17..1344 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 17:29:36 Download gff for BO28578.complete
Subject Subject Range Query Range Percent Splice Strand
bam-RA 82..1407 17..1344 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 17:29:36 Download gff for BO28578.complete
Subject Subject Range Query Range Percent Splice Strand
3R 25244489..25244976 17..504 99   Minus
3R 25244054..25244424 505..875 100 <- Minus
3R 25243524..25243992 876..1344 99 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 02:12:05 Download gff for BO28578.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 21070211..21070698 17..504 99   Minus
arm_3R 21069776..21070146 505..875 100 <- Minus
arm_3R 21069246..21069714 876..1344 99 <- Minus

BO28578.pep Sequence

Translation from 16 to 1360

> BO28578.pep
MLNARDVCPEGNDDQQLDHNFKQMEEHLALMVEGNENEDPRKATCEYEDT
NEDGATCTSGVLSEIQENFGRLRLCDVTAPLLEFHGLDCLQQIQKRSRHF
AFDGSPAKKSRSGGVLVTGPKQKQLQKENVWNRKSKGSASADNIEKLPIT
IEKLHMIGLHGDCLEHNAVLRLMNLFRSLHDHLTADLGFSRQNSMPSDYL
FDMPVKSTMPKSLNVRYQLQVLCTKVERFLVQQRRTLEANRHFDFEKYDE
CDKLLKGFASYLDNFKLLLKPKMRNRNGNSGSNADKFHTQRMERLLIGLR
DWIKAAHLSVHVFNWEMDLEHRYSGAMTESHKSLNERAILLSGAELRAAE
ARGISAEDLFIAQRYKLGGPIYCVLEQHEFLSALIANPETYFPPSVVAIC
GPQKLGAVSMEQPSASEEEFEETEEVPSSPPRHTGRVPRFRSASFLDH

BO28578.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 06:56:16
Subject Length Description Subject Range Query Range Score Percent Strand
bam-PA 442 CG10422-PA 1..442 1..442 2324 100 Plus