Clone BO28579 Report

Search the DGRC for BO28579

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:285
Well:79
Vector:pDNR-Dual
Associated Gene/TranscriptCG7956-RA
Protein status:BO28579.pep: Imported from assembly
Sequenced Size:3034

Clone Sequence Records

BO28579.complete Sequence

3034 bp assembled on 2011-08-04

GenBank Submission: KX799233

> BO28579.complete
GAAGTTATCAGTCGACATGGAGGTGTTCCAGACCGACTCGCACTATATCT
TCGTGAAGCGGGACAAGAGTTTGTGGTGGCACCGAAGGACGTCTGAGTTC
TCCATAAAAGCAGGATGGGATCTCAGTTCTGTGGACGACATAGAATGCAT
TGGCGTGACACACGGAATTGTTGGTGTAATCTCACTGCCCAATGTCTATG
AACCCCATTTAGTTGTGGTAAAGGAGGCTTCGGCAGTGGGCGTTCTATAT
CCACCACACTTGGTGTACAAAATCAAGTCGATATGCATTCTGAGTGCCGA
CGATCCGGACACCGATTTGCCCAATTGCACCAAGCACACCAAGAGCAACC
AGTCCACGCCCACCCACAGCGTCTCCACCTCCAACAACAACAATGCCAGC
GTTCCGTCGAGCGGCGGAGGCTCCTCAAAGAGCACCAAACTATTCGAAGG
CATGAACAAGACGTGGGGCGCCGTAAAGAGTGCAGGCAACACTATTAAGA
ATACTACCCAGCAAGCTGCGAATTTGGCCACCAAGCAGGTTAAGTCATCT
GTGGGCATTCGGGAGCCCAGGCATATTGAACGCCGCATAACGGAGGAATT
ACACAAGATATTCGACGAGACGGACAGCTTTTATTTCAGCTTCGACTGCG
ATATCACCAACAATCTGCAGCGCCATGAGGCCAAATCGGAGGAAAGTCAG
TCTCAGCCGGATGAGAGATTCTTTTGGAACAAGCATATGATAAGAGATTT
GATTAACTTGAATGACAAAACTTGGATACTCCCCATCATTCAGGGATTCA
TGCAAGTTGAAAATTGTGTCATAGGCAATGAATGCTTCACCTTGGCCTTG
GTTTCGCGAAGATCGCGTCATCGTGCGGGAACACGCTACAAGAGACGGGG
CGTAGACGAAAAGGGAAACTGTGCCAATTACGTAGAAACGGAACAAATAC
TCTCATTCCGTCATCACCAGCTTTCCTTCACCCAAGTGCGTGGATCTGTG
CCTATCTACTGGAGCCAGCCGGGCTACAAGTATCGCCCACCACCACGCCT
CGATCGAGGGGTTGCCGAGACCCAACAGGCCTTTGAACTGCACTTTACCA
AGGAACTGGAGACCTATGGGCGGGTGTGCATCGTCAATTTGGTTGAGCAG
AGCGGAAAGGAGAAGACAATTGGAGATGCTTATGCAGATCACGTGATTAA
GTTGAACAACGACCGATTGATATATGTAACCTTTGACTTTCACGATTACT
GCCGCGGCATGCGCTTCGAGAATGTGTCGGCTCTAATCGACGCAGTAGGC
CCTGAGGCAGGTGCAATGGGCTTCCACTGGCGGGATCAACGTGGAATGAT
ATGCAACCAAAAATCCGTGTTTAGGGTAAATTGCATGGACTGCCTAGATA
GAACGAATGTGGTGCAAACGGCTATTGGCAAGGCTGTACTCGAATCTCAG
CTAGTGAAACTGGGCCTCTCGCCGCCTTATACTCCCATTCCGGAGCAGCT
GAAATCTCCGTTTATGGTGCTATGGGCAAACAATGGCGACATAATAAGTA
GGCAGTATGCAGGCACAAATGCATTAAAGGGAGACTATACTCGCACCGGT
GAGCGCAAAATCAGCGGTATGATGAAAGACGGCATGAACTCCGCCAATCG
TTATTATTTGGCGCGATTTAAGGACTCGTATCGACAGGCCACCATAGATT
TGATGCTAGGCAACCAGGTCTCCTCGGAGTCACTCAGTGCTTTGGGCGGA
CAAGCTGGCCCAGATGAAAATGACGGAACGGAAAATGCCGAGCAAGCCAA
GTTGCTAGTGGAAGATTGTCGTCGCCTGCTGCTGGGAACTGCTCAGTATC
CTGTTGGAGCTTGGGGACTAATAGATGCTGACCCAAGCTCCGGCGATATC
AACGAAACAGAGGTAGATACTATTTTGTTGCTCACAGACGATTGCTATAT
TGTTGCCGAATACGACTCACATCTGGACAAGATTGTGCGCTTTGAGAAGG
TGCAACTGACGCAGGTGCGTCTCATAGAGTTGGGCATGCATCAGCAGACG
AAAATTTTTCAGGGATCCGCTCCAGCGCATCTTTGTCTGCGTCTGAACTA
CAGTGTAGACGAGCAAGAGGGCTACTTTCACATGTTTCGCTCGGCCAATC
TAAGATTCTTTAACAACATGGCCTATGTGATCAAGACGCAGGAGGAGGTA
GCCGAGTCCATGACTTCAATTGTCGAGATGTTCCGCATTGCCCTGGATAA
TGCAGGGAATACAGAAGTACGATACATTACGGGTGGGGTGCTGCAGCGAA
GAAAGAGCAAGTTGCCCACTTTGGATGTTCCAAGAGGCATGCCACGCAAC
CTTTCCGAATCTCAGCTGGTACAGTTAAGCTCAAAGGCACTTTCAAATAT
GGCGGGACAGTTCTCGAAATTGGGACAGACCTTCAAAAAGCCGCAAGCCC
ATCCCAGCAGCCTGGCAGCTACTATGAATCCACAAGTAATGCGTCAGAGA
GACAGCGAAATAGAATCTGGCCAGGAAGCGGAAAAGGCAGTTTTCACACT
GGGTCGCAAGCATCGAAATTCCAACAGCGCAAGCAGCACCGATACCGATG
AGCATGACAACAGTTTGTACGAGCCCGAGGTGGACTCGGATGTGGAGATA
GCTATGGACAAGTCCAACTACAACGAGAACGCCTTTCTGCCGTCGGTGGG
TATTGTAATGGGTAATCAGAAGGAGGACTCGCCTAGCTCCTCCGATGAAA
TTCGACATTTGGAGCAGAAGGATAGCATGTGCAAAACCACAGAGGATGTG
CTAACCATTTCCATAACCTCCGTGACGGACCACGTTGGTCTGCCCACGGG
CCTTCTGGAAAATGCACCGGCCATCCGACCGATTACGCCAAATCCGTTGA
TCTGTGTGGAAGCTCACGAAGCATTTGATGACAGGGAGGAGGGGGTGAAG
CCTGTGTCCAGTGCCTGCTCCATACCACATACACTCAGGCTGTTTCTGGC
CAAAAATCGCTCAAAAGCAAGCTTTCTAGACCAT

BO28579.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 01:08:43
Subject Length Description Subject Range Query Range Score Percent Strand
CG7956-RA 3003 CG7956-PA 1..3000 17..3016 15000 100 Plus
CG7956-RD 3213 CG7956-PD 1..2946 17..2962 14730 100 Plus
CG7956-RG 2964 CG7956-PG 1..2945 17..2961 14725 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 01:08:44
Subject Length Description Subject Range Query Range Score Percent Strand
CG7956-RA 3543 CG7956-RA 128..3128 16..3016 15005 100 Plus
CG7956-RD 4343 CG7956-RD 128..3074 16..2962 14735 100 Plus
CG7956-RG 3796 CG7956-RG 128..3073 16..2961 14730 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 01:08:41
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 21525827..21526902 1886..2961 5380 100 Plus
3R 32079331 3R 21523083..21523509 338..764 2120 99.8 Plus
3R 32079331 3R 21523751..21524117 885..1251 1835 100 Plus
3R 32079331 3R 21524187..21524516 1251..1580 1650 100 Plus
3R 32079331 3R 21525526..21525763 1650..1887 1190 100 Plus
3R 32079331 3R 21522801..21523033 111..343 1165 100 Plus
3R 32079331 3R 21523567..21523688 764..885 610 100 Plus
3R 32079331 3R 21521055..21521153 16..114 495 100 Plus
3R 32079331 3R 21524566..21524649 1567..1650 375 96.4 Plus
3R 32079331 3R 21527153..21527210 2959..3016 290 100 Plus
Blast to na_te.dros performed on 2014-11-27 01:08:42 has no hits.

BO28579.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-08-04 17:43:42 Download gff for BO28579.complete
Subject Subject Range Query Range Percent Splice Strand
CG7956-RA 116..3111 17..3012 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 04:46:14 Download gff for BO28579.complete
Subject Subject Range Query Range Percent Splice Strand
CG7956-RA 129..3124 17..3012 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 02:19:26 Download gff for BO28579.complete
Subject Subject Range Query Range Percent Splice Strand
CG7956-RA 129..3124 17..3012 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 02:19:26 Download gff for BO28579.complete
Subject Subject Range Query Range Percent Splice Strand
3R 21527156..21527206 2962..3012 100   Plus
3R 21525829..21526902 1888..2961 100 -> Plus
3R 21525527..21525763 1651..1887 100 -> Plus
3R 21524583..21524649 1584..1650 100 -> Plus
3R 21524188..21524519 1252..1583 99 -> Plus
3R 21523752..21524117 886..1251 100 -> Plus
3R 21523567..21523688 764..885 100 -> Plus
3R 21523088..21523508 343..763 100 -> Plus
3R 21522804..21523032 114..342 100 -> Plus
3R 21521056..21521152 17..113 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 04:46:14 Download gff for BO28579.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 17352878..17352928 2962..3012 100   Plus
arm_3R 17351551..17352624 1888..2961 100 -> Plus
arm_3R 17351249..17351485 1651..1887 100 -> Plus
arm_3R 17350305..17350371 1584..1650 100 -> Plus
arm_3R 17349910..17350241 1252..1583 99 -> Plus
arm_3R 17349474..17349839 886..1251 100 -> Plus
arm_3R 17349289..17349410 764..885 100 -> Plus
arm_3R 17348810..17349230 343..763 100 -> Plus
arm_3R 17348526..17348754 114..342 100 -> Plus
arm_3R 17346778..17346874 17..113 100 -> Plus

BO28579.pep Sequence

Translation from 16 to 3034

> BO28579.pep
MEVFQTDSHYIFVKRDKSLWWHRRTSEFSIKAGWDLSSVDDIECIGVTHG
IVGVISLPNVYEPHLVVVKEASAVGVLYPPHLVYKIKSICILSADDPDTD
LPNCTKHTKSNQSTPTHSVSTSNNNNASVPSSGGGSSKSTKLFEGMNKTW
GAVKSAGNTIKNTTQQAANLATKQVKSSVGIREPRHIERRITEELHKIFD
ETDSFYFSFDCDITNNLQRHEAKSEESQSQPDERFFWNKHMIRDLINLND
KTWILPIIQGFMQVENCVIGNECFTLALVSRRSRHRAGTRYKRRGVDEKG
NCANYVETEQILSFRHHQLSFTQVRGSVPIYWSQPGYKYRPPPRLDRGVA
ETQQAFELHFTKELETYGRVCIVNLVEQSGKEKTIGDAYADHVIKLNNDR
LIYVTFDFHDYCRGMRFENVSALIDAVGPEAGAMGFHWRDQRGMICNQKS
VFRVNCMDCLDRTNVVQTAIGKAVLESQLVKLGLSPPYTPIPEQLKSPFM
VLWANNGDIISRQYAGTNALKGDYTRTGERKISGMMKDGMNSANRYYLAR
FKDSYRQATIDLMLGNQVSSESLSALGGQAGPDENDGTENAEQAKLLVED
CRRLLLGTAQYPVGAWGLIDADPSSGDINETEVDTILLLTDDCYIVAEYD
SHLDKIVRFEKVQLTQVRLIELGMHQQTKIFQGSAPAHLCLRLNYSVDEQ
EGYFHMFRSANLRFFNNMAYVIKTQEEVAESMTSIVEMFRIALDNAGNTE
VRYITGGVLQRRKSKLPTLDVPRGMPRNLSESQLVQLSSKALSNMAGQFS
KLGQTFKKPQAHPSSLAATMNPQVMRQRDSEIESGQEAEKAVFTLGRKHR
NSNSASSTDTDEHDNSLYEPEVDSDVEIAMDKSNYNENAFLPSVGIVMGN
QKEDSPSSSDEIRHLEQKDSMCKTTEDVLTISITSVTDHVGLPTGLLENA
PAIRPITPNPLICVEAHEAFDDREEGVKPVSSACSIPHTLRLFLAKNRSK
ASFLDH

BO28579.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 07:14:08
Subject Length Description Subject Range Query Range Score Percent Strand
CG7956-PA 1000 CG7956-PA 1..1000 1..1000 5223 100 Plus
CG7956-PD 1070 CG7956-PD 1..982 1..982 5130 100 Plus
CG7956-PG 987 CG7956-PG 1..981 1..981 5126 100 Plus
CG7956-PF 1142 CG7956-PF 1..573 1..573 2964 97.2 Plus
CG7956-PE 662 CG7956-PE 1..573 1..573 2964 97.2 Plus
CG7956-PF 1142 CG7956-PF 618..1054 546..982 2231 100 Plus