Clone BO28580 Report

Search the DGRC for BO28580

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:285
Well:80
Vector:pDNR-Dual
Associated Gene/TranscriptLsm11-RA
Protein status:BO28580.pep: Imported from assembly
Sequenced Size:802

Clone Sequence Records

BO28580.complete Sequence

802 bp assembled on 2011-07-13

GenBank Submission: KX799012

> BO28580.complete
GAAGTTATCAGTCGACATGGAATCGAGGGACCGGAAAACTTCGAATGAGG
ACGACTCGTCGGAAATCTCCGAATTGGATGTGGGCAGTGATAGGTTTAAT
CCTCTGCGAGCGTTATACGAACCCAATTTTAGGGTGACCGATGCTGTTCC
AAAGGTCATCTACCAGAATCTGGCTGCCTTCGAGAGTGCACTTAAAAAAT
TCGGCATCTGGCAGCTGAACAAGCGCCAAAAGCCGGGATCCGCAGAAGGA
GGAGATCAGGGGACATCGAAAAAGGCTTCCACTTCCGAGGCTGTAGATAT
TCTACCTCCTGAGCGACGTTTTGAGCCGCACCAGATGCCTACCACTAGTA
GCAGAAAGAAGCATCATCGAAATATTTTCACCTACATGGAGGCAGCTGTC
GGTCCATTGGAACTCCTAACGAAGTGCATATCCCCTGCTAGCCACAATGA
ATCCAACGAAAGGAGAAGAGTTCGGGTGGTGATTCGCAAACACGGATCGG
TGGGCGGCAGTGTCGAGGGTGAACTGTTGGCCTTTGACAAGCAGTGGAAC
CTCCTACTGAGGAATGTTACCGAAACCTGGAAGCGACGAAAGTACAATTA
CGGAGAGCAAAACATATGCGACACACCTGTTGATTGCACAGGCCGCCTCA
AGGAGTTGGGTATCACTCTTCCCAGGACTGTAGTCAAAAATCTAAACCGA
AAAAACGTGGAGATTCGGCGAGAGCTCCCACAGATTTTAATACGCGGCGA
GAATGTGGTTCTAGTTAGTTTAATACCAACAAAAGCAAGCTTTCTAGACC
AT

BO28580.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 16:57:30
Subject Length Description Subject Range Query Range Score Percent Strand
Lsm11-RA 771 CG12924-PA 1..768 17..784 3825 99.9 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:57:32
Subject Length Description Subject Range Query Range Score Percent Strand
Lsm11-RA 1067 CG12924-RA 87..855 16..784 3830 99.9 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 16:57:29
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 9838646..9839414 784..16 3830 99.9 Minus
Blast to na_te.dros performed on 2014-11-26 16:57:29 has no hits.

BO28580.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-07-13 12:41:15 Download gff for BO28580.complete
Subject Subject Range Query Range Percent Splice Strand
Lsm11-RA 88..851 17..780 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 02:14:04 Download gff for BO28580.complete
Subject Subject Range Query Range Percent Splice Strand
Lsm11-RA 88..851 17..780 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 17:31:34 Download gff for BO28580.complete
Subject Subject Range Query Range Percent Splice Strand
Lsm11-RA 88..851 17..780 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 17:31:34 Download gff for BO28580.complete
Subject Subject Range Query Range Percent Splice Strand
2R 9838650..9839413 17..780 99   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 02:14:04 Download gff for BO28580.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 5726155..5726918 17..780 99   Minus

BO28580.pep Sequence

Translation from 16 to 802

> BO28580.pep
MESRDRKTSNEDDSSEISELDVGSDRFNPLRALYEPNFRVTDAVPKVIYQ
NLAAFESALKKFGIWQLNKRQKPGSAEGGDQGTSKKASTSEAVDILPPER
RFEPHQMPTTSSRKKHHRNIFTYMEAAVGPLELLTKCISPASHNESNERR
RVRVVIRKHGSVGGSVEGELLAFDKQWNLLLRNVTETWKRRKYNYGEQNI
CDTPVDCTGRLKELGITLPRTVVKNLNRKNVEIRRELPQILIRGENVVLV
SLIPTKASFLDH

BO28580.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 06:56:54
Subject Length Description Subject Range Query Range Score Percent Strand
Lsm11-PA 256 CG12924-PA 1..256 1..256 1326 100 Plus