Clone BO28582 Report

Search the DGRC for BO28582

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:285
Well:82
Vector:pDNR-Dual
Associated Gene/Transcriptbe-RC
Protein status:BO28582.pep: Imported from assembly
Sequenced Size:2509

Clone Sequence Records

BO28582.complete Sequence

2509 bp assembled on 2011-08-04

GenBank Submission: KX798081

> BO28582.complete
GAAGTTATCAGTCGACATGAATTCGCGACGGATTGCTCTGGTCCTCCTAA
TCGGCATAATCGTTTCGTTTTCTGGCCATGATGCACTAACCTATCCGGAG
CGCTTCGATCGCCTGCCCACTTGGGGTGGTCATTCCCAAATTGGTGGGCC
GCTGCTGGATACCGCCCACCGGGAGAATCGTGAGAAAAGGGAGAATAGGG
TGGACCTGTGCCGGCACTGTTTCTGCATTCATCTCAAGGCAATCTGTGAT
TACAAGCTTAACAAAACGCTCCCGAACGAATTTAACGATAAACTATTGGT
GCCGCTGAACATCAAATATATTGAGGTGCGACTGACTGTTGGCACCCAGT
TCGTGATGTACGAGAACTTCTTCCAGGACAACCAGGTGAACTACTTTGGT
GTAATCGGAGTGGGGAAAGATGACCAGGTGGAAATAACCAGCAATGCATT
TAGCCACAACAAAGGCGGTTTTCCCAACATCGAAATACGAAATGTATTGC
GAGTTTTTCTGCGTGAGAAATTCCTGACCGGTGCGGACTACAAGCTGCTG
GTGGAGGATGTTACTCAGCTGTCCGTATTCTCCAATGCCCTTCAGATGAC
TAATCTAGACTGTTCTCTCAAGCGGATCAAGGAGCTGAATCTGATGAAGA
ACGCTTTCAATCCTGGGGTTGCCAAATATGGAATAAATCTCCGCATCGAG
GATTCGAACATCAATCAGCTGGGTATATTCGGCGTGTCCATGGGCAAGGT
GAGCCTGTTGCGCTGCCACATCGACATGATCATGAGCAACGCCTTTGACG
TTACCAGCATCAAGGAGCTGATTATCGAGGGCTGCAATATCGAGGTGATC
GAGAGCCAGGCGCTAACCAACAAATTGCATAGCGATAAGGTGGCCATCGT
GGATACGGTGATCGGTACGATTGAGGGTCAGGCGATCAGTCAGAGCGGTA
TAACTACCATGATTATGTTTGGAAATACAATTACAAAAATACGTTCGAAT
GCCATTCAAATTGTTGCCGTTAGTCTGTTCATACGCAACAATTCAATGAG
CCATGTGGAGCCCAATTGGTTGAGTGTCAGCCAGGCCGATCAAGTGGAGA
TTGCGAATAATCGCTTCGAGGACTACGGACGCTGTGAACTGAACATTGGC
TCCTCGAACTGCAGTTTTCGCAACAATATACTGCAGAATCCGCAATCGGG
TAGCCTCAATTTTACATGTCGCGTCCACCAGGTGCGCGTGGGCACCGAGT
GCTCGTGCAACAAGTCCTGGCTATCGGAGCTAACCGATCATGATCTGGAA
TCGGAAATCATGTGTCAGGTGGCAAAGCGTGATGCCAACTGCTTTAATGC
CACCAATACGGATGTCCGCCGGTATGTCAACGAGGCATGTGGCAGCAATG
TGACCCGCTACTGTATGGGTGGCCAGTGGGTGACCAAGGCGGTCAGTGAT
CATTCTAGCGACTCCAGCAAATTGACCATCGGAATGATAGCCCTTGAGAT
TGTGATTTTAACACTCTTGCTTGTTGCGATTGTCTGTGTGTTGGCCAAAA
ACTGTGGCAGTGGAAGCTGCGCTCCTGCCGGTGGCCAGTCCACTGATAAT
TGCCTAATCGAGGAGGACATTCGCAACTCACTGCGCCAGCTCGCACTGCA
CAGCGAGAGCAATAAGACACGCAAGGCTATACTGAAGCTGATCAATGGTC
ATTTGAGCAAGGGGGAGTGCAACGATCGGATACTCTTTATAGTGGACAAC
ATGCCGCAAAATCAGGCGATCGAAAGCCTGCTGTTTAGGCACATATCGCA
GAGTCACATGGAGCCCAGTGATAGTGAGGCATATGCCAGCACCGCCTTAA
CAGCCAATGCAACAGCACCACCACTGCCGCCCAGTACCGATTCCAGTGAG
CCCATCTACCAAGAGCTCGACCAGCAACGACTGATCATCGACGACAAGTA
CTCATTGCCGCTGAATTCCGACGAGGATCCGCCGTACTCGGAGCCGTCCA
ATATGATGAATACGAACGACATGCCACCGGCATATCAATATGCCACACCG
ATGCGCATCCTGCCATGCCACCAGATGCAGCATCAGCAGCCGTCGACGAC
GGCCAATTATGCCATCCCCGTTTGGAGGTCCACTCCAAGTGCCACGCCCA
CTAGCCGCCCACCCTCGGGCTCACAGGAGGGGTCGGCCACCGCCACAGCG
CCCAGAGCTGTCAAGGATTTGCGGCAGGCTCTGCAGAACTCCCCACAGTT
CCATCCCAACCAGCTGACCTCAACGCGCAACCAAAGACAAATCCTGCAGA
TTCTGCCGCCGCTTCAGCCGCCGCCGTACACTCAGAGGTCACAGGTCAGG
GGTCAGCGGAGGCGCAGCTTCGAGTGCCTCGATGGCGCCGCCAGCTTGGC
GGCCATGGAGCACATGGACTCCGGCTCGGATCACTCTGGCGGCAGTGATG
TGACCGTCCAAATTGCTGATGTGATCGACTACGCGGATGCCGCAAGCTTT
CTAGACCAT

BO28582.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 01:07:26
Subject Length Description Subject Range Query Range Score Percent Strand
be-RF 2478 CG32594-PF 1..2475 17..2491 12375 100 Plus
be-RC 2478 CG32594-PC 1..2475 17..2491 12375 100 Plus
be-RB 2103 CG32594-PB 1..1993 17..2009 9965 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 01:07:27
Subject Length Description Subject Range Query Range Score Percent Strand
be-RF 3069 CG32594-RF 268..2742 17..2491 12375 100 Plus
be-RC 3240 CG32594-RC 268..2742 17..2491 12375 100 Plus
be-RB 4014 CG32594-RB 268..2260 17..2009 9965 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 01:07:24
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 15031543..15032573 979..2009 5155 100 Plus
X 23542271 X 15033606..15034087 2010..2491 2410 100 Plus
X 23542271 X 15031178..15031467 689..978 1450 100 Plus
X 23542271 X 15030585..15030849 268..532 1325 100 Plus
X 23542271 X 15024703..15024954 17..268 1260 100 Plus
X 23542271 X 15030910..15031068 530..688 795 100 Plus
Blast to na_te.dros performed on 2014-11-27 01:07:25 has no hits.

BO28582.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-08-04 17:43:41 Download gff for BO28582.complete
Subject Subject Range Query Range Percent Splice Strand
be-RC 270..2744 17..2493 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 04:45:36 Download gff for BO28582.complete
Subject Subject Range Query Range Percent Splice Strand
be-RC 268..2742 17..2493 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 02:19:00 Download gff for BO28582.complete
Subject Subject Range Query Range Percent Splice Strand
be-RC 268..2742 17..2493 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 02:19:00 Download gff for BO28582.complete
Subject Subject Range Query Range Percent Splice Strand
X 15033606..15034087 2010..2493 99   Plus
X 15031543..15032573 979..2009 100 -> Plus
X 15031178..15031467 689..978 100 -> Plus
X 15030911..15031068 531..688 100 -> Plus
X 15030586..15030847 269..530 100 -> Plus
X 15024703..15024954 17..268 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 04:45:36 Download gff for BO28582.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 14927639..14928120 2010..2493 99   Plus
arm_X 14925576..14926606 979..2009 100 -> Plus
arm_X 14925211..14925500 689..978 100 -> Plus
arm_X 14924944..14925101 531..688 100 -> Plus
arm_X 14924619..14924880 269..530 100 -> Plus
arm_X 14918736..14918987 17..268 100 -> Plus

BO28582.pep Sequence

Translation from 16 to 2509

> BO28582.pep
MNSRRIALVLLIGIIVSFSGHDALTYPERFDRLPTWGGHSQIGGPLLDTA
HRENREKRENRVDLCRHCFCIHLKAICDYKLNKTLPNEFNDKLLVPLNIK
YIEVRLTVGTQFVMYENFFQDNQVNYFGVIGVGKDDQVEITSNAFSHNKG
GFPNIEIRNVLRVFLREKFLTGADYKLLVEDVTQLSVFSNALQMTNLDCS
LKRIKELNLMKNAFNPGVAKYGINLRIEDSNINQLGIFGVSMGKVSLLRC
HIDMIMSNAFDVTSIKELIIEGCNIEVIESQALTNKLHSDKVAIVDTVIG
TIEGQAISQSGITTMIMFGNTITKIRSNAIQIVAVSLFIRNNSMSHVEPN
WLSVSQADQVEIANNRFEDYGRCELNIGSSNCSFRNNILQNPQSGSLNFT
CRVHQVRVGTECSCNKSWLSELTDHDLESEIMCQVAKRDANCFNATNTDV
RRYVNEACGSNVTRYCMGGQWVTKAVSDHSSDSSKLTIGMIALEIVILTL
LLVAIVCVLAKNCGSGSCAPAGGQSTDNCLIEEDIRNSLRQLALHSESNK
TRKAILKLINGHLSKGECNDRILFIVDNMPQNQAIESLLFRHISQSHMEP
SDSEAYASTALTANATAPPLPPSTDSSEPIYQELDQQRLIIDDKYSLPLN
SDEDPPYSEPSNMMNTNDMPPAYQYATPMRILPCHQMQHQQPSTTANYAI
PVWRSTPSATPTSRPPSGSQEGSATATAPRAVKDLRQALQNSPQFHPNQL
TSTRNQRQILQILPPLQPPPYTQRSQVRGQRRRSFECLDGAASLAAMEHM
DSGSDHSGGSDVTVQIADVIDYADAASFLDH

BO28582.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 07:14:05
Subject Length Description Subject Range Query Range Score Percent Strand
be-PF 825 CG32594-PF 1..825 1..825 4290 100 Plus
be-PC 825 CG32594-PC 1..825 1..825 4290 100 Plus
be-PB 700 CG32594-PB 1..665 1..665 3441 99.8 Plus