Clone BO28583 Report

Search the DGRC for BO28583

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:285
Well:83
Vector:pDNR-Dual
Associated Gene/TranscriptVps36-RA
Protein status:BO28583.pep: Imported from assembly
Sequenced Size:1231

Clone Sequence Records

BO28583.complete Sequence

1231 bp assembled on 2011-07-13

GenBank Submission: KX795399

> BO28583.complete
GAAGTTATCAGTCGACATGAATCGCTTCGCTTATGTGGAGGCCCGTCTGA
GTCCCAATGAATCCTTCGTCAGCCGCGACAACAGGGTAAAAATATACGAT
GGCGACCAAAAGACGGACTTTGAAGACGGCGAAGTGGTGCTCACCACACA
CCGACTGTTTTGGGGTCGCCCTGGAGAGATTGCCCGGGCCGCCGTAACAC
TTTGCCTGCCACTCAGCTATGTGATATCCGTCAGCGAAGAGACTACTGCC
TCTAACTTCTTTGGCCGCAAGACTCGCATAATCATGCATCTGCATCCTCC
AACGTCGGACAAAGGACCCGGCCCACTGGACACCAGTCGCGCCACCCACA
TCAAACTGTCGGGCAAGAATGGCCTGAGTGTCGAGTTCCACAGTGCCTTG
CGGGAGACTCTAAATGCCCGCGTCTGGGAAATCCTCTTGACCAGCGAGAT
CATCATCAATGGCGTGGCCAGCAGTCCAACCTTGGAGCCTGCCAACGACA
GGCTGGCCCGCATTCAGAAGAGGACAGGAATTGGGGGCATCGAACGGCAT
TTGGAGGCAAAAGCCAAGGCCACGGATGAGAACATAGCACTTGCCTTTCA
GGATCTCAGTGTTCTAATGGCCATGGCCAAGGACATGGTAGGAGTGTCCA
AGACAATAAGCAGCAAGATACGCAAACAGAAGGGAGAAATATCTGACGAT
GAAACGGTGCGTTTCAAATCCTACCTCATGAGCCTGGGCATCGATGATCC
CGTCACGCGGGACAACTTTACCAGCAATTCTGCCTACTTCAGTAGCCTGG
CCCGACAGATTTGCGAAATGCTGCTGGATCCTATCGAGGAGCAAGGTGGC
ATGATGTCCTTGGCTGATGTCTACTGTCGTGTAAACCGCGCTCGTGGTCT
GGAACTGCTATCGCCTGAGGACTTGCTGCACGCCTGCGAGCAGCTTAGTG
GTCCAATACGCCTGCGCAGCTTTCCCAGTGGCGCTAGAGTGCTACAACTG
GAGTCCCACGATGATGCCCTAATTGCCGTTGACACATTGGAGAAGGTGGA
GGCTGCCGAGTCTCTGGCTGTGGAGGAACTGGCCAAGCAGCTGGGAATTT
CACTCCTGCTGGCCAAGGAGCGATTGCTAGTGGCCGAACGTTTGGGCAAG
GTGTGTCGCGACGAGTCCGTAGAGGGACTGCGGTTCTATCCAAATCTTCT
GCTAGGCCGGGACGCAAGCTTTCTAGACCAT

BO28583.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:34:51
Subject Length Description Subject Range Query Range Score Percent Strand
Vps36-RA 1200 CG10711-PA 1..1197 17..1213 5985 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:34:52
Subject Length Description Subject Range Query Range Score Percent Strand
Vps36-RA 1346 CG10711-RA 89..1285 17..1213 5985 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 21:34:50
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 13512139..13512867 839..111 3645 100 Minus
3L 28110227 3L 13511707..13512083 1213..837 1885 100 Minus
3L 28110227 3L 13512929..13513024 112..17 480 100 Minus
Blast to na_te.dros performed on 2014-11-26 21:34:50 has no hits.

BO28583.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-07-13 13:21:43 Download gff for BO28583.complete
Subject Subject Range Query Range Percent Splice Strand
Vps36-RA 84..1280 17..1215 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 03:30:47 Download gff for BO28583.complete
Subject Subject Range Query Range Percent Splice Strand
Vps36-RA 89..1285 17..1215 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:36:59 Download gff for BO28583.complete
Subject Subject Range Query Range Percent Splice Strand
Vps36-RA 89..1285 17..1215 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 22:36:59 Download gff for BO28583.complete
Subject Subject Range Query Range Percent Splice Strand
3L 13512929..13513024 17..112 100   Minus
3L 13512140..13512865 113..838 100 <- Minus
3L 13511705..13512081 839..1215 99 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 03:30:47 Download gff for BO28583.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 13506029..13506124 17..112 100   Minus
arm_3L 13505240..13505965 113..838 100 <- Minus
arm_3L 13504805..13505181 839..1215 99 <- Minus

BO28583.pep Sequence

Translation from 16 to 1231

> BO28583.pep
MNRFAYVEARLSPNESFVSRDNRVKIYDGDQKTDFEDGEVVLTTHRLFWG
RPGEIARAAVTLCLPLSYVISVSEETTASNFFGRKTRIIMHLHPPTSDKG
PGPLDTSRATHIKLSGKNGLSVEFHSALRETLNARVWEILLTSEIIINGV
ASSPTLEPANDRLARIQKRTGIGGIERHLEAKAKATDENIALAFQDLSVL
MAMAKDMVGVSKTISSKIRKQKGEISDDETVRFKSYLMSLGIDDPVTRDN
FTSNSAYFSSLARQICEMLLDPIEEQGGMMSLADVYCRVNRARGLELLSP
EDLLHACEQLSGPIRLRSFPSGARVLQLESHDDALIAVDTLEKVEAAESL
AVEELAKQLGISLLLAKERLLVAERLGKVCRDESVEGLRFYPNLLLGRDA
SFLDH

BO28583.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 06:57:18
Subject Length Description Subject Range Query Range Score Percent Strand
Vps36-PA 399 CG10711-PA 1..399 1..399 2004 100 Plus