Clone BO28585 Report

Search the DGRC for BO28585

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:285
Well:85
Vector:pDNR-Dual
Associated Gene/TranscriptCG6356-RA
Protein status:BO28585.pep: Imported from assembly
Sequenced Size:1744

Clone Sequence Records

BO28585.complete Sequence

1744 bp assembled on 2011-07-13

GenBank Submission: KX799551

> BO28585.complete
GAAGTTATCAGTCGACATGACTCAATCCACGGAGAATCCGGAGAAGAATC
GCGAGCTGATCAGCGAGGAAAGCATGAAGGATCTGCTCACCAAGCAGCTG
GAAGTCGTTGGCAGTGGCGGGGCATTTGTGTGGGCGATCTTCTTCCTGTG
TGTCACTCCCAATATACTGAACGGATTCCATGTGTCATCCTATACGCTGC
TGGGCCACCTACCCGATGACCAGTGGTGCGGCATTCCGGAGCTGCAGGAC
ACCAACTGGACACACGCCCAGAAGCGGGAGATTGTCGCCAAGGGATTGGA
TTCGGGCGGTTGCACCGTGTGGGACTGGAACTATGGCCACCTGGCCAAGA
TGTCCTACGAGGCAGCCCTGAACTATACCGGCCATCTGACGCAGATTTCC
CCGCCGGCTGAGGTATCCTGCCGTGTAAAGGGGCAACATGAGTTCGCCCA
TCCCGAGACCACCTTCGTTGCGGACTGGGATCTCACCTGCGACCGGAGCA
TCCAGCGTACCTCCGCCCAGGTTTCCATATCGTTGGGCAAGTTCTGCGGA
TCCTTCTCCTTTGGCATCCTGGCCGACAAATTTGGTCGCAAATCCTCATT
CACCCTGGGCGCTGCCTTCTTTATTGTGGGCAGCTTCTTCTGTACCTTCT
CGCCCTGGTACAGCCTCTTCCTGGCCGGACGTTTCGCCCTAGGAGCAGCC
TCCTCTGGTCTGTTCTATCCAGCATTTACCATGATCGTGGAGAACATCTG
CTTGAAGCATCGTTCCTGGATGTCCATTGCCTTCTCAGCGTCCTATCCGG
TGGGCATGATCATCCTGGCCATTGTGGGCTACGTCATCCAACCGTGGAGA
CATCTGCAACTGGCTCTCACCATTCCTTCGCTGCTGCTCATTCTGAACTG
CTACCTGATGAGTGAGTCACCCCGCTGGCTGATCACGAACCAAAGATATG
ATCGCGTCTACAAGATTCTCTTCAGACAGCCCAGCCATTACCAAATTCAG
CCCGCCGTTGCAGCCCCATCTCAAGTCGCCAGCGATAAGAAGTCGCTGGA
GCCCGAAGAGGGATTCTCCTTTGGACAGAAACTCAAGAATGGTCCCCTGA
AGTCCATCATCGAGCTGTATGCCAACTCCAAGGTGCGCAGGATGATCTTT
GCCTCGTATTTCATGTTCTGTGTCACTTCGCTGAGTTACTATGTGACGGC
TCTCAATGCCGCCAATTTGTCGGTGTCCAGATACCTATACATTATAGGCA
CCGGTCTGGTGGATATACCCTCCTATCTCGTCCCTGTGATAATGCTGCGC
TTTACGGGCCGTCGCCTCACCACCATGTTCCTGTTCCTGTGGACCGGCGT
GTCCTTGCTGCTTGTCCTTGCTGTTCCCGCCGGCAGCACCACCTGGATCG
TGGCCTTCGCCATGCTGGGTCGCTTTGGTATTAGCGCCACCTACTCCGTG
GTCACGCTCTACACAGCCGAGCTGTATCCCACCCAGATAAGAAACTCGGC
TTTGGGAACCTGCTCCACCTTCGCCCATGTGGGCTCCATTTCGGCACCGT
ATGTGGTCGATGTCCTTGGAGCTCTGGGCTGGTACATTCCAACAACGATT
TGCGGCTGCTGCGTTCTAGTAGCTGGCCTACTGACTCTCACACTTCCGGA
AACGGGAACGGGTAAGCTGTCCGACAAAGTGGAGAGCAGTGCGTCCTCCA
CTCCGACGGAGCCGGCCGAGAAACAGGCAAGCTTTCTAGACCAT

BO28585.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:34:10
Subject Length Description Subject Range Query Range Score Percent Strand
CG6356-RA 1713 CG6356-PA 1..1710 17..1726 8550 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:34:11
Subject Length Description Subject Range Query Range Score Percent Strand
CG6356-RA 2887 CG6356-RA 774..2484 16..1726 8555 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 21:34:08
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 24287687..24288214 1199..1726 2640 100 Plus
3R 32079331 3R 24286280..24286727 132..579 2240 100 Plus
3R 32079331 3R 24287004..24287172 735..903 845 100 Plus
3R 32079331 3R 24286792..24286946 580..734 775 100 Plus
3R 32079331 3R 24287474..24287628 1045..1199 775 100 Plus
3R 32079331 3R 24287235..24287376 904..1045 710 100 Plus
3R 32079331 3R 24284728..24284845 16..133 590 100 Plus
Blast to na_te.dros performed on 2014-11-26 21:34:08 has no hits.

BO28585.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-07-13 13:10:09 Download gff for BO28585.complete
Subject Subject Range Query Range Percent Splice Strand
CG6356-RA 596..2305 17..1728 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 03:30:23 Download gff for BO28585.complete
Subject Subject Range Query Range Percent Splice Strand
CG6356-RA 775..2484 17..1728 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:36:39 Download gff for BO28585.complete
Subject Subject Range Query Range Percent Splice Strand
CG6356-RA 775..2484 17..1728 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 22:36:39 Download gff for BO28585.complete
Subject Subject Range Query Range Percent Splice Strand
3R 24287688..24288214 1200..1728 99   Plus
3R 24287475..24287628 1046..1199 100 -> Plus
3R 24287235..24287376 904..1045 100 -> Plus
3R 24287004..24287172 735..903 100 -> Plus
3R 24286792..24286946 580..734 100 -> Plus
3R 24286281..24286727 133..579 100 -> Plus
3R 24284729..24284844 17..132 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 03:30:23 Download gff for BO28585.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 20113410..20113936 1200..1728 99   Plus
arm_3R 20113197..20113350 1046..1199 100 -> Plus
arm_3R 20112957..20113098 904..1045 100 -> Plus
arm_3R 20112726..20112894 735..903 100 -> Plus
arm_3R 20112514..20112668 580..734 100 -> Plus
arm_3R 20112003..20112449 133..579 100 -> Plus
arm_3R 20110451..20110566 17..132 100 -> Plus

BO28585.pep Sequence

Translation from 16 to 1744

> BO28585.pep
MTQSTENPEKNRELISEESMKDLLTKQLEVVGSGGAFVWAIFFLCVTPNI
LNGFHVSSYTLLGHLPDDQWCGIPELQDTNWTHAQKREIVAKGLDSGGCT
VWDWNYGHLAKMSYEAALNYTGHLTQISPPAEVSCRVKGQHEFAHPETTF
VADWDLTCDRSIQRTSAQVSISLGKFCGSFSFGILADKFGRKSSFTLGAA
FFIVGSFFCTFSPWYSLFLAGRFALGAASSGLFYPAFTMIVENICLKHRS
WMSIAFSASYPVGMIILAIVGYVIQPWRHLQLALTIPSLLLILNCYLMSE
SPRWLITNQRYDRVYKILFRQPSHYQIQPAVAAPSQVASDKKSLEPEEGF
SFGQKLKNGPLKSIIELYANSKVRRMIFASYFMFCVTSLSYYVTALNAAN
LSVSRYLYIIGTGLVDIPSYLVPVIMLRFTGRRLTTMFLFLWTGVSLLLV
LAVPAGSTTWIVAFAMLGRFGISATYSVVTLYTAELYPTQIRNSALGTCS
TFAHVGSISAPYVVDVLGALGWYIPTTICGCCVLVAGLLTLTLPETGTGK
LSDKVESSASSTPTEPAEKQASFLDH

BO28585.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 06:57:11
Subject Length Description Subject Range Query Range Score Percent Strand
CG6356-PA 570 CG6356-PA 1..570 1..570 2984 100 Plus
Orct-PB 548 CG6331-PB 10..533 31..569 553 27.2 Plus
Orct-PA 548 CG6331-PA 10..533 31..569 553 27.2 Plus
Orct2-PB 567 CG13610-PB 10..512 31..546 541 28.4 Plus
Orct2-PA 567 CG13610-PA 10..512 31..546 541 28.4 Plus