Clone BO28595 Report

Search the DGRC for BO28595

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:285
Well:95
Vector:pDNR-Dual
Associated Gene/TranscriptCG32712-RB
Protein status:BO28595.pep: Imported from assembly
Sequenced Size:583

Clone Sequence Records

BO28595.complete Sequence

583 bp assembled on 2011-07-13

GenBank Submission: KX797188

> BO28595.complete
GAAGTTATCAGTCGACATGTGGAAGAGCCTGGGACTCGGTTGCGGTCTAC
TTTCTCTTGGCGCCTTCATCTCCTGCTTTGTGGCGCTGCACATGCTCAAC
CAGATTATTCACATCGAACTGGACGCCTCCGTTGACGTGACCATGCAATT
GGAGGCCGACAAAGATTTGGACGTACGCTGCCATGGCACCCTGATCGTTG
GCAATCCGGATGCAGCGCATCTTAGCCGGCAGGAGTTATCGTATTTGCGC
TGGACGGTGGTGTTCACGCTGCTCTACTCCTTCGCGACCACGCTCCTCAT
CCGGGCCAAGTACTTGGGCAATTTTGAGATTAGCCTGGCCACCTCCAATG
CGATGATGCTGATGGGATCCCTGCTATCGGTGCTTCTGGTTATGGTCACC
GTTGCTCTCCATCAGCATGAACCATTCCCGGATCTGCGGTGCAACCAGTT
GGTTGTCTACCACTTGTACTACATCGCCCTGAACACCGCCATCTCAGTGG
TGTTCTTCCTGGTCCATTCCATTCAGGAGCTGCTGCTGCATCGTTTACAG
CCGACATTGAAGTACGCAAGCTTTCTAGACCAT

BO28595.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 16:53:12
Subject Length Description Subject Range Query Range Score Percent Strand
CG32712-RB 552 CG32712-PB 1..549 17..565 2745 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:53:14
Subject Length Description Subject Range Query Range Score Percent Strand
CG32712-RB 600 CG32712-RB 16..564 17..565 2745 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 16:53:10
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 8433389..8433673 352..68 1425 100 Minus
X 23542271 X 8433123..8433336 565..352 1070 100 Minus
X 23542271 X 8433744..8433794 67..17 255 100 Minus
Blast to na_te.dros performed on 2014-11-26 16:53:12 has no hits.

BO28595.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-07-13 10:17:15 Download gff for BO28595.complete
Subject Subject Range Query Range Percent Splice Strand
CG32712-RB 16..564 17..567 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 02:12:16 Download gff for BO28595.complete
Subject Subject Range Query Range Percent Splice Strand
CG32712-RB 16..564 17..567 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 17:29:45 Download gff for BO28595.complete
Subject Subject Range Query Range Percent Splice Strand
CG32712-RB 16..564 17..567 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 17:29:45 Download gff for BO28595.complete
Subject Subject Range Query Range Percent Splice Strand
X 8433744..8433794 17..67 100   Minus
X 8433389..8433673 68..352 100 <- Minus
X 8433121..8433335 353..567 99 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 02:12:16 Download gff for BO28595.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 8327777..8327827 17..67 100   Minus
arm_X 8327422..8327706 68..352 100 <- Minus
arm_X 8327154..8327368 353..567 99 <- Minus

BO28595.pep Sequence

Translation from 16 to 583

> BO28595.pep
MWKSLGLGCGLLSLGAFISCFVALHMLNQIIHIELDASVDVTMQLEADKD
LDVRCHGTLIVGNPDAAHLSRQELSYLRWTVVFTLLYSFATTLLIRAKYL
GNFEISLATSNAMMLMGSLLSVLLVMVTVALHQHEPFPDLRCNQLVVYHL
YYIALNTAISVVFFLVHSIQELLLHRLQPTLKYASFLDH

BO28595.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 06:56:20
Subject Length Description Subject Range Query Range Score Percent Strand
CG32712-PB 183 CG32712-PB 1..183 1..183 933 100 Plus