Clone BO28604 Report

Search the DGRC for BO28604

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:286
Well:4
Vector:pDNR-Dual
Associated Gene/TranscriptCG14185-RA
Protein status:BO28604.pep: Imported from assembly
Sequenced Size:1269

Clone Sequence Records

BO28604.complete Sequence

1269 bp assembled on 2011-07-13

> BO28604.complete
GAAGTTATCAGTCGACATGCCACTGCTGGAGGCACCTGCGGACTACCTGG
AGTCCTCTCCGGATCAATCGCTTCAGGCGGAACTGCCCATCCTTCTGGCA
CCGCCAGGACCGGCCGCCTTGGCCCAGGTCCGGATGCCTCCGCCCGAGGT
GCGGCTCAATCAGCAGAATCCCGCACAGCAGCAGCAGCAGCGGATGCAGT
TCAACCGCCGCCAACTGGGTCGCCGGAACTCCTTCGATCGGGATGTGGCC
ATTGCCGAGGAGGAACAGCACCTTCCGGCCTTCGTCCACCTGCTGCCCGT
GGTGCTACCCCAACAGGGCCCGGAACCGACACTGGACGAGCTACTGCGCC
GAGTGACGCAACGCACGGATCTGGAGGCGGTGGAGCAAGTGCGTCTGCGC
GTGATCTCTTACACAGTCAGCCTGTCCCGCCTGTCGCTCTTCCTGCCGCG
CCTCCAATCCCTCGACCTGAGTGGCAGTGTGCTGAGCTCCCTGCGCGACC
TGGGCTATGGACTCCTCCAGCTAACCCGGTTGGACATCAGCAACTGCGGC
CTGAATAGCTTCGACGGCACCAGTGGACTGCCGGCCATCCGTGTGCTCAT
CGCCGATGGAAACATGATCCAGCGGGTTGATCCGCTGGCCGAACTGGTCC
ACCTGCGCGTTCTCAAGGCAAGGAACAACCGGATCAGTGAGCTGGGCCTG
CTCTCCTTCTTGGGAATGTGCCCGCAGCTGCAGGAGGTGGAGTTGCAGGG
CAATCCCGTGTGTCGTTTACCGCTCTACCGCTCGCTCCTGGCGCGCAGTG
TGCCCACGTTGCAACTGTTGGATGGACGGGTGTTGAACGGTGAACCTGCT
CCGGTGGAGATGGAGGAGGCCACATCCCCGGCATCAAGTGATCTGGAGTC
TGGCTCCGAGACGACTGCACAACGGCCGAACACGGCGCCTGCTCCGGAAC
CCGTTCCTATCGCCTTGAATGCTGCCATCCGGCGCCAAGTGTCGGCCAGC
TCTGGCTCCACTCCAGTGGCCGGATCGGTTTTGAGCCTGGTGCGCCAGCG
GCGAAGGCGCAGTGGCCACGCCTGGGTCAGTTCCTCCTCCTCCAGCGGAT
CGTCTTCCGCCTCCTCTGCCCGATCCACGCGGGCGCCATCAATGAGCTCC
TGCTCCTCCAACAGCAGCCTCGACGTCCAATCATCGTCCCATTATGTCTT
CAGCACACAGTCAACGCTGGACGCAAGCTTTCTAGACCATTCGTTTGGCG
CGCAAAACGCAGGTAAGTG

BO28604.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 16:54:14
Subject Length Description Subject Range Query Range Score Percent Strand
CG14185-RA 1209 CG14185-PA 1..1206 17..1222 6030 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:54:15
Subject Length Description Subject Range Query Range Score Percent Strand
CG14185-RA 1397 CG14185-RA 28..1233 17..1222 6030 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 16:54:12
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 20106517..20107393 346..1222 4385 100 Plus
3L 28110227 3L 20106121..20106450 17..346 1650 100 Plus
Blast to na_te.dros performed on 2014-11-26 16:54:13 has no hits.

BO28604.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-07-13 10:17:17 Download gff for BO28604.complete
Subject Subject Range Query Range Percent Splice Strand
CG14185-RA 28..1233 17..1222 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 02:12:42 Download gff for BO28604.complete
Subject Subject Range Query Range Percent Splice Strand
CG14185-RA 28..1233 17..1222 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 17:30:11 Download gff for BO28604.complete
Subject Subject Range Query Range Percent Splice Strand
CG14185-RA 28..1233 17..1222 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 17:30:11 Download gff for BO28604.complete
Subject Subject Range Query Range Percent Splice Strand
3L 20106518..20107393 347..1222 100   Plus
3L 20106121..20106450 17..346 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 02:12:42 Download gff for BO28604.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 20099618..20100493 347..1222 100   Plus
arm_3L 20099221..20099550 17..346 100 -> Plus

BO28604.pep Sequence

Translation from 16 to 1267

> BO28604.pep
MPLLEAPADYLESSPDQSLQAELPILLAPPGPAALAQVRMPPPEVRLNQQ
NPAQQQQQRMQFNRRQLGRRNSFDRDVAIAEEEQHLPAFVHLLPVVLPQQ
GPEPTLDELLRRVTQRTDLEAVEQVRLRVISYTVSLSRLSLFLPRLQSLD
LSGSVLSSLRDLGYGLLQLTRLDISNCGLNSFDGTSGLPAIRVLIADGNM
IQRVDPLAELVHLRVLKARNNRISELGLLSFLGMCPQLQEVELQGNPVCR
LPLYRSLLARSVPTLQLLDGRVLNGEPAPVEMEEATSPASSDLESGSETT
AQRPNTAPAPEPVPIALNAAIRRQVSASSGSTPVAGSVLSLVRQRRRRSG
HAWVSSSSSSGSSSASSARSTRAPSMSSCSSNSSLDVQSSSHYVFSTQST
LDASFLDHSFGAQNAGK

BO28604.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 06:56:28
Subject Length Description Subject Range Query Range Score Percent Strand
CG14185-PA 402 CG14185-PA 1..402 1..402 1993 100 Plus