Clone BO28618 Report

Search the DGRC for BO28618

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:286
Well:18
Vector:pDNR-Dual
Associated Gene/TranscriptPif1B-RA
Protein status:BO28618.pep: Imported from assembly
Sequenced Size:3157

Clone Sequence Records

BO28618.complete Sequence

3157 bp assembled on 2011-08-31

GenBank Submission: KX794722

> BO28618.complete
GAAGTTATCAGTCGACATGTACATGCAGCATGAGCGACATTCCGACAGCG
ACCCCAACTCCCGCCATCAACAAACCGAGGCATCCCACATGAGAGACCAC
TGGAAGCCGTCAAAATCCCAACAGTCGCAACAATCTGATCGTGTAGACCC
TCATGACAAGCCATCGCAGACGGCGGTCTCCTTTCTGCAGAAACACCACA
CGCCTAAGAACCCGGAATCGAAGGCTAATCCAGATGATGGGGCGTCCTGC
TCATGCACCGCAAAGAGGTCCAAGTCCGCCGATCCACCAGCGGTTAAAGC
TCACACCTGTGCATGCAACACCGATCCAAGTCCATGTGGACTGGGTCATC
AGGAGAAATCCAGTTCGAGGAAGCCCTGCTCCCAGAAAACATCGGTTACG
GAACCAGAGAAGGCTTCCTCATTCAAGAGTGCTATAACAGCGTGTACCAA
GGAGCTCCTCGATCCCTGCACTTGTGGCGCCCACCCACCATACTGGGCTG
GTCAAAGCAACTTGGTAACCGGACCATCCTACAGTAGAGCAATGGACCCC
TCCTCAAGCACTCTCGCTCCCTTGCATAGACCCGGAGCATCAAAAGGCAG
CTTTGGTCGATCCAAGAGTTTGGCCAGTCTGCCTAGTAAATCTAATCCGC
CAACTCAGAGTGGCGTCACTTGGTTGTCGGCTTTAAAGGATCCGGAGAGT
ACATGTTGCTCTTCCAAAGAGGACGAACGTCCTGCATGTACCTGCAACGC
TACCCAGACTAATCAGGATCCTTCTATGAGTTCACTTCCTCAGAGCCATC
CCAATTATCGCAGTATGACATCCAAATCAAGTAATTTCAGGGCGCCAAAC
CCGCGCAATCAACCCTCCTTTGGGCCAGGCGATGAGACCTCAGCAACCAC
ACGATCCCAATCGATTGTGGGTCAGGTCACCTGCCTATGCGCATCGGAGC
ATCAACCCACCAAGGCCTTTGTGTCGAGCCTGGCCGATCGGGAATGCCCA
AATGAGATCCAGATTGCGCCATGCCCCTCCACAAGAATACACCATCCATC
CGGGTTTGCCCAGTTCACCGATTGTCAGAACTCTCAAGGCGACCCCAGTA
CCTCTTTCCGTTCTAGGAAAGTGAGCGTTAAGGGTCAGGAGGAATTTTGT
GACTGTGATGCTTCTGATAACTTCTCCGAACTGTCCGATCCCATCCAGAC
CAGTCTTCATACGCACAGGAGTCTTTCCGGGGGTAGTTGCCTGTGCAACG
ACGATGCAGATCCTCCGAAGGAACCCGAAAAGGCTACGTGTGTCAGCAAG
CAGTGCCAGTGCTCTTCGAATGACGAGCTTCAGGGGATGCAAAGTGCCCA
AGCGGGTACCGGCTATCAGACACCAGAGGATCTTTGTGGAAATAGGGCTA
TGGCCTGCTGTTCTCGTAAGGAACGCATCCTGATGCTGATGGAGAAACTG
ACCAGTCCTGGTTGCGATTGCGGTATATCTCGCCCCTGCCTGACCCAACA
ACTTTTCCGGGAACTAACACTACTCCTGAGATCAGAAAAAGATGATGCAG
TTGCACCAGCGGATGAAGCTAGCCCACCGTGCCTAACCTTCGATGAGTGC
TGTACGGCCCAACATGCTGGCAATGGGGAAGGCGATCCAGTCGAAAAACC
CCCGTCAAAGAGAGAGCTCCAACGAGTCGAGTGCTTTCATCAACTGGAGG
AATACCTCTGCAAGTGCTTCCTGCCGCCGGCAGAACCTCAGATTCCTGAG
ACCGATATCTATGCTTTTGAACTAGATCCGGACTTTCCACCAGAACCTGA
GCCAAAATCTCCCAAGGAAAATGACAACATGCAACCTTGTCAGTGCCCGG
AACAATTCTTTGACATTGGAAATGCACTAACCTGTTCGGGTGATGGCTTG
GATGATGACTTCTTTCGTGATTGTGAGGATGACGAGGAAGTAAAAAAGTT
CGAAAGTAAGGATGATGGTAAAGCAACCACGGAGCCGGATCTCTGCCAAT
CTCTTAAAGCATTCATCGACAAGGAACTGCAAGAAATTCTTGCGGAGGAG
GCCAATAAGGAAGGCGAGGAGGTAGAAGAAAAAACTCCTAGCACAGTACT
AAGGGAAATCTGTGAGAGACCCACAACCGTGGCGTCACCGGAAGAAGAGG
AGAAACCAGAACAGATTGAGTGTCCATTTGCTGGCATGGTGTCCTGTCCT
CCTTGGACCACACAGCAAACAGACTGGGCAGCCTTCCCCTACAACTTAGA
TCCCTGTGCGCAAAAGGAGTCACCTAGCCCGGCGCCCCGGGGTCCACGTA
CTGGGCTATTGCCCGAAGGACCTCTGTCACCCGATATGAGGAACCTCTGC
GAGCAGCTTTTGCGAAAAGCTCTTAAGGATTGTGGTCTGTGTGGTGGTGA
CGATGTGTACTCCTGCGAGGACGATGTATGCGAAGAGTGCGCGCTGAATT
GTGAGGAATGCCCGGAAGATTGCCCGTTGGAAAAGTGCGAGGAATGCGAT
GATGAGTGTCCCCCAGAACAACAAGGATGCCTATGCTGCCACTGTCGCGC
TCTCATATGCGACGAGGAGTGCAAGACGGTTGCCAATACCCTGCGCTCCG
GAATGTGTGATCCACTCTGCGAAATGAAATACTTTATAGACTCCATCATC
GTTGATATGCATGCCATGGATTGTGTGCTCGGCAACAAGAAAGCGAAACC
AAAGCACCTTAAGGCTACAGACTTGACCAACAGAGGTGGACCCGGCGATA
GTTTTCCCGTCAAAATTAAGAGTGTGTGGCCATTGGGTAACACCGCTCTC
TACGTCCAATGGCAATTGGAGGACTGTCGCGCTGTAGCAGGATATGAGAT
TTACTTGGATGGGCATTTGACGAACCGATTTTACAGTTTTCGTCACGAGG
CCGGAGTTATTACCAATGCGGATGTGACCAATCCGCACCAGGTTGTGGTG
CGCGCCGTAGCGGTGGGTCAGGAGTTTCCCGGCGAGGGTCCGGGTAAGGA
TGCGACCCAGGAATGTGGCTGCCAGGCGGTGGCACTTGCTCATCCCGAAT
TGAAGGCGGGAGCACAGAGGCCGTGGTCGCCCAGTCTCTACTATTATGAT
CCCAACCAATTGCCGCCGGCGGAGGACGTGCAGCCGTGCGCAAGCTTTCT
AGACCAT

BO28618.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 01:25:08
Subject Length Description Subject Range Query Range Score Percent Strand
Pif1B-RD 3126 CG33720-PD 1..3123 17..3139 15615 100 Plus
Pif1B-RC 3126 CG33720-PC 1..3123 17..3139 15615 100 Plus
Pif1B-RB 3126 CG33720-PB 1..3123 17..3139 15615 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 01:25:09
Subject Length Description Subject Range Query Range Score Percent Strand
Pif1A-RA 6324 CG42599-RA 2872..5994 17..3139 15615 100 Plus
Pif1A-RH 7694 CG42599-RH 4242..7364 17..3139 15615 100 Plus
Pif1A-RG 7761 CG42599-RG 4309..7431 17..3139 15615 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 01:25:05
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 8775318..8777927 2626..17 13050 100 Minus
3R 32079331 3R 8774616..8774908 3139..2847 1465 100 Minus
3R 32079331 3R 8774971..8775120 2848..2699 735 99.3 Minus
3R 32079331 3R 8775183..8775261 2704..2626 395 100 Minus
Blast to na_te.dros performed on 2014-11-27 01:25:06 has no hits.

BO28618.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-08-31 09:30:40 Download gff for BO28618.complete
Subject Subject Range Query Range Percent Splice Strand
Pif1B-RB 696..3818 17..3141 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 04:53:23 Download gff for BO28618.complete
Subject Subject Range Query Range Percent Splice Strand
Pif1A-RG 4309..7431 17..3141 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 02:25:04 Download gff for BO28618.complete
Subject Subject Range Query Range Percent Splice Strand
Pif1A-RG 4309..7431 17..3141 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 02:25:04 Download gff for BO28618.complete
Subject Subject Range Query Range Percent Splice Strand
3R 8775318..8777927 17..2626 100   Minus
3R 8775183..8775260 2627..2704 100 <- Minus
3R 8774971..8775114 2705..2848 100 <- Minus
3R 8774614..8774906 2849..3141 99 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 04:53:23 Download gff for BO28618.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 4601040..4603649 17..2626 100   Minus
arm_3R 4600905..4600982 2627..2704 100 <- Minus
arm_3R 4600693..4600836 2705..2848 100 <- Minus
arm_3R 4600336..4600628 2849..3141 99 <- Minus

BO28618.pep Sequence

Translation from 16 to 3157

> BO28618.pep
MYMQHERHSDSDPNSRHQQTEASHMRDHWKPSKSQQSQQSDRVDPHDKPS
QTAVSFLQKHHTPKNPESKANPDDGASCSCTAKRSKSADPPAVKAHTCAC
NTDPSPCGLGHQEKSSSRKPCSQKTSVTEPEKASSFKSAITACTKELLDP
CTCGAHPPYWAGQSNLVTGPSYSRAMDPSSSTLAPLHRPGASKGSFGRSK
SLASLPSKSNPPTQSGVTWLSALKDPESTCCSSKEDERPACTCNATQTNQ
DPSMSSLPQSHPNYRSMTSKSSNFRAPNPRNQPSFGPGDETSATTRSQSI
VGQVTCLCASEHQPTKAFVSSLADRECPNEIQIAPCPSTRIHHPSGFAQF
TDCQNSQGDPSTSFRSRKVSVKGQEEFCDCDASDNFSELSDPIQTSLHTH
RSLSGGSCLCNDDADPPKEPEKATCVSKQCQCSSNDELQGMQSAQAGTGY
QTPEDLCGNRAMACCSRKERILMLMEKLTSPGCDCGISRPCLTQQLFREL
TLLLRSEKDDAVAPADEASPPCLTFDECCTAQHAGNGEGDPVEKPPSKRE
LQRVECFHQLEEYLCKCFLPPAEPQIPETDIYAFELDPDFPPEPEPKSPK
ENDNMQPCQCPEQFFDIGNALTCSGDGLDDDFFRDCEDDEEVKKFESKDD
GKATTEPDLCQSLKAFIDKELQEILAEEANKEGEEVEEKTPSTVLREICE
RPTTVASPEEEEKPEQIECPFAGMVSCPPWTTQQTDWAAFPYNLDPCAQK
ESPSPAPRGPRTGLLPEGPLSPDMRNLCEQLLRKALKDCGLCGGDDVYSC
EDDVCEECALNCEECPEDCPLEKCEECDDECPPEQQGCLCCHCRALICDE
ECKTVANTLRSGMCDPLCEMKYFIDSIIVDMHAMDCVLGNKKAKPKHLKA
TDLTNRGGPGDSFPVKIKSVWPLGNTALYVQWQLEDCRAVAGYEIYLDGH
LTNRFYSFRHEAGVITNADVTNPHQVVVRAVAVGQEFPGEGPGKDATQEC
GCQAVALAHPELKAGAQRPWSPSLYYYDPNQLPPAEDVQPCASFLDH

BO28618.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 08:04:22
Subject Length Description Subject Range Query Range Score Percent Strand
Pif1B-PD 1041 CG33720-PD 1..1041 1..1041 5740 100 Plus
Pif1B-PC 1041 CG33720-PC 1..1041 1..1041 5740 100 Plus
Pif1B-PB 1041 CG33720-PB 1..1041 1..1041 5740 100 Plus
Pif1B-PA 1041 CG33720-PA 1..1041 1..1041 5740 100 Plus