Clone BO28621 Report

Search the DGRC for BO28621

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:286
Well:21
Vector:pDNR-Dual
Associated Gene/TranscriptGpdh-RB
Protein status:BO28621.pep: Imported from assembly
Sequenced Size:1114

Clone Sequence Records

BO28621.complete Sequence

1114 bp assembled on 2011-07-13

GenBank Submission: KX794783

> BO28621.complete
GAAGTTATCAGTCGACATGGCGGATAAAGTAAATGTGTGCATTGTGGGCT
CCGGCAACTGGGGTTCGGCCATAGCGAAAATCGTGGGCGCCAATGCCGCC
GCTCTGCCGGAGTTCGAGGAGCGTGTGACGATGTTCGTCTACGAGGAGCT
CATCGATGGCAAGAAGCTGACGGAGATTATCAACGAGACGCACGAGAACG
TCAAGTACCTGAAAGGACACAAGCTGCCCCCGAATGTGGTTGCCGTGCCC
GACCTGGTTGAGGCCGCCAAGAACGCTGACATCCTGATCTTCGTGGTGCC
CCACCAGTTCATTCCCAACTTCTGCAAACAGCTACTGGGCAAGATTAAGC
CAAATGCCATCGCTATCTCCCTGATCAAGGGCTTCGACAAGGCCGAGGGC
GGCGGCATCGATCTGATCTCGCATATAATCACGCGTCACCTGAAGATCCC
ATGCGCCGTGTTGATGGGCGCAAACCTGGCCAACGAGGTGGCTGAGGGCA
ACTTCTGCGAAACGACAATCGGCTGCACGGACAAGAAGTATGGCAAGGTG
CTGCGCGATCTCTTCCAGGCGAACCACTTCCGCGTGGTGGTCGTGGACGA
TGCTGATGCCGTGGAGGTTTGCGGTGCCCTCAAGAACATCGTGGCCTGCG
GCGCTGGCTTTGTTGATGGCCTCAAGCTGGGCGACAACACCAAGGCGGCT
GTCATCCGGCTGGGCCTCATGGAGATGATTCGCTTCGTGGACGTCTTCTA
TCCCGGAAGCAAGCTGTCCACCTTCTTCGAGAGCTGCGGCGTGGCCGATC
TGATCACGACGTGTTACGGTGGCCGTAACCGCCGCGTCTCTGAGGCGTTT
GTGACTTCTGGAAAAACCATTGAGGAGCTGGAGAAGGAAATGCTCAACGG
CCAGAAGCTGCAGGGCCCACCCACTGCCGAGGAGGTCAACTACATGCTGA
AGAACAAGGGTCTGGAGGACAAATTCCCCCTGTTCACGGCTATTCACAAA
ATATGCACAAATCAGCTCAAGCCTAATGATTTAATTGATTGCATACGCAA
TCACCCTGAGCATATGGATACGTCCATCATGCCGTCGCCAAAACTTGCAA
GCTTTCTAGACCAT

BO28621.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 16:58:52
Subject Length Description Subject Range Query Range Score Percent Strand
Gpdh-RF 1083 CG9042-PF 1..1080 17..1096 5400 100 Plus
Gpdh-RB 1083 CG9042-PB 1..1080 17..1096 5400 100 Plus
Gpdh-RG 1062 CG9042-PG 1..1050 17..1066 5250 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:58:53
Subject Length Description Subject Range Query Range Score Percent Strand
Gpdh-RF 2503 CG9042-RF 468..1547 17..1096 5400 100 Plus
Gpdh-RB 1651 CG9042-RB 146..1225 17..1096 5400 100 Plus
Gpdh-RG 2078 CG9042-RG 468..1517 17..1066 5250 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 16:58:50
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 5946314..5946690 444..820 1885 100 Plus
2L 23513712 2L 5946043..5946250 238..445 1040 100 Plus
2L 23513712 2L 5944267..5944447 60..240 905 100 Plus
2L 23513712 2L 5947017..5947171 818..972 775 100 Plus
2L 23513712 2L 5947240..5947333 973..1066 470 100 Plus
2L 23513712 2L 5944110..5944154 17..61 225 100 Plus
Blast to na_te.dros performed on 2014-11-26 16:58:51 has no hits.

BO28621.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-07-13 12:47:03 Download gff for BO28621.complete
Subject Subject Range Query Range Percent Splice Strand
Gpdh-RB 429..1508 17..1098 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 02:14:43 Download gff for BO28621.complete
Subject Subject Range Query Range Percent Splice Strand
Gpdh-RB 146..1225 17..1098 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 17:32:15 Download gff for BO28621.complete
Subject Subject Range Query Range Percent Splice Strand
Gpdh-RB 146..1225 17..1098 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 17:32:15 Download gff for BO28621.complete
Subject Subject Range Query Range Percent Splice Strand
2L 5947857..5947887 1066..1098 93   Plus
2L 5947240..5947332 973..1065 100 -> Plus
2L 5947018..5947171 819..972 100 -> Plus
2L 5946316..5946688 446..818 100 -> Plus
2L 5946044..5946250 239..445 100 -> Plus
2L 5944268..5944445 61..238 100 -> Plus
2L 5944110..5944153 17..60 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 02:14:43 Download gff for BO28621.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 5947857..5947887 1066..1098 93   Plus
arm_2L 5947240..5947332 973..1065 100 -> Plus
arm_2L 5947018..5947171 819..972 100 -> Plus
arm_2L 5946316..5946688 446..818 100 -> Plus
arm_2L 5946044..5946250 239..445 100 -> Plus
arm_2L 5944268..5944445 61..238 100 -> Plus
arm_2L 5944110..5944153 17..60 100 -> Plus

BO28621.pep Sequence

Translation from 16 to 1114

> BO28621.pep
MADKVNVCIVGSGNWGSAIAKIVGANAAALPEFEERVTMFVYEELIDGKK
LTEIINETHENVKYLKGHKLPPNVVAVPDLVEAAKNADILIFVVPHQFIP
NFCKQLLGKIKPNAIAISLIKGFDKAEGGGIDLISHIITRHLKIPCAVLM
GANLANEVAEGNFCETTIGCTDKKYGKVLRDLFQANHFRVVVVDDADAVE
VCGALKNIVACGAGFVDGLKLGDNTKAAVIRLGLMEMIRFVDVFYPGSKL
STFFESCGVADLITTCYGGRNRRVSEAFVTSGKTIEELEKEMLNGQKLQG
PPTAEEVNYMLKNKGLEDKFPLFTAIHKICTNQLKPNDLIDCIRNHPEHM
DTSIMPSPKLASFLDH

BO28621.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 06:56:58
Subject Length Description Subject Range Query Range Score Percent Strand
Gpdh-PF 360 CG9042-PF 1..360 1..360 1875 100 Plus
Gpdh-PB 360 CG9042-PB 1..360 1..360 1875 100 Plus
Gpdh-PE 350 CG9042-PE 1..350 1..350 1824 100 Plus
Gpdh-PA 350 CG9042-PA 1..350 1..350 1824 100 Plus
Gpdh-PG 353 CG9042-PG 1..350 1..350 1824 100 Plus