Clone BO28627 Report

Search the DGRC for BO28627

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:286
Well:27
Vector:pDNR-Dual
Associated Gene/TranscriptCG8128-RA
Protein status:BO28627.pep: Imported from assembly
Sequenced Size:1059

Clone Sequence Records

BO28627.complete Sequence

1059 bp assembled on 2011-07-13

> BO28627.complete
GAAGTTATCAGTCGACATGTTGGCCACCGGTTTTCTGGCTCGCAGAACCG
TACTTAACCAGCCGGCGTTCAATTCATGGAGCACACTCCTCCGGACCGCT
AGAAAACGACCCACATCCACGGTTGCCGCCAGAGTTCCATTAAAGCTTCA
GTCACAGCAGCAATTTACAAGAGCATACTCGTCCTCCAAAACCATGGACA
CGCCGGCGGATGTATTCCGCGGCATTACGGATCGATTTGCCGGAGTAACA
GTCGATGGGCGCGAGGAGAACGTGGACAAATCCAGTTTCCGGGACAAGCT
CACAAAATCCCTGGACTTTTGGACGACGAACAAGAACCGGGCCATTTGGT
TCCGCGTGTACAAGGAGCAGGCTGATTGGGTGCCCATTCTGGCGGAGAAC
GGCTTTGATTTCCATCATGCCAAGACCGGTGTGGTGGTCATGTACCGCTG
GTTGCCGGAGCACGAGTCTAGCAACCTACCCACCTACGCCCACACGCTAA
TGGGCGTCGGCGGACTGGTTATCAACGAACAGGACGAGGTGCTGGTGGTG
TCCGATCGTTTTGCAATGATACCAAACAGCTGGAAGCTGCCCGGCGGCTA
TGTGGAGCCGCGGGAGAATCTCATCGATGCGGCAATACGAGAGGTGGCCG
AGGAGACGGGAATCCGCACCGAATTCCGCTCAGTGGTCAGTCTGCGGCAT
GCCCATGGCGGCACCTTCGGCTGCTCCGACATGTACGTGGTCATCGCCCT
AAAGCCACTGAATTTGGACTTTACGCGCTGCGAACGCGAGATAGCGCGCA
TCCAGTGGATGCCCATCGCGGAGTATCTGAAGCATCCGCAGGTCCACGAG
ACGAACAGGCAGTTCGTCTGCACCTTTTTGGACTACCAGAAGCGCGGCCT
GACCCTCACCTGTCGCGACGAAGTGCATCAGGTGCTAAAGAAGAAATACA
ATCTGTATTACGTGGATCGGGAGCAGCCACAGGAGCAGCAGGATAAAAAG
AATTCGGCAAGCTTTCTAGACCTATTCGTTTGGCGCTGCGAAAAAGGGGG
GAGGGTTAA

BO28627.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 16:55:11
Subject Length Description Subject Range Query Range Score Percent Strand
CG8128-RB 993 CG8128-PB 1..990 17..1006 4950 100 Plus
CG8128-RA 993 CG8128-PA 1..990 17..1006 4950 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:55:12
Subject Length Description Subject Range Query Range Score Percent Strand
CG8128-RB 1809 CG8128-RB 648..1637 17..1006 4950 100 Plus
CG8128-RA 1530 CG8128-RA 369..1358 17..1006 4950 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 16:55:09
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 15699162..15699862 306..1006 3505 100 Plus
X 23542271 X 15698521..15698687 17..183 835 100 Plus
X 23542271 X 15698760..15698881 184..305 610 100 Plus
Blast to na_te.dros performed on 2014-11-26 16:55:10 has no hits.

BO28627.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-07-13 10:17:20 Download gff for BO28627.complete
Subject Subject Range Query Range Percent Splice Strand
CG8128-RA 363..1355 22..1014 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 02:13:07 Download gff for BO28627.complete
Subject Subject Range Query Range Percent Splice Strand
CG8128-RA 374..1366 22..1014 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 17:30:34 Download gff for BO28627.complete
Subject Subject Range Query Range Percent Splice Strand
CG8128-RA 374..1366 22..1014 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 17:30:34 Download gff for BO28627.complete
Subject Subject Range Query Range Percent Splice Strand
X 15699162..15699882 306..1028 98 -> Plus
X 15698760..15698881 184..305 100 -> Plus
X 15698526..15698687 22..183 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 02:13:07 Download gff for BO28627.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 15593195..15593915 306..1028 98 -> Plus
arm_X 15592793..15592914 184..305 100 -> Plus
arm_X 15592559..15592720 22..183 100 -> Plus

BO28627.pep Sequence

Translation from 16 to 1057

> BO28627.pep
MLATGFLARRTVLNQPAFNSWSTLLRTARKRPTSTVAARVPLKLQSQQQF
TRAYSSSKTMDTPADVFRGITDRFAGVTVDGREENVDKSSFRDKLTKSLD
FWTTNKNRAIWFRVYKEQADWVPILAENGFDFHHAKTGVVVMYRWLPEHE
SSNLPTYAHTLMGVGGLVINEQDEVLVVSDRFAMIPNSWKLPGGYVEPRE
NLIDAAIREVAEETGIRTEFRSVVSLRHAHGGTFGCSDMYVVIALKPLNL
DFTRCEREIARIQWMPIAEYLKHPQVHETNRQFVCTFLDYQKRGLTLTCR
DEVHQVLKKKYNLYYVDREQPQEQQDKKNSASFLDLFVWRCEKGGRV

BO28627.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 06:56:36
Subject Length Description Subject Range Query Range Score Percent Strand
CG8128-PB 330 CG8128-PB 1..330 1..330 1742 100 Plus
CG8128-PA 330 CG8128-PA 1..330 1..330 1742 100 Plus