Clone BO28634 Report

Search the DGRC for BO28634

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:286
Well:34
Vector:pDNR-Dual
Associated Gene/Transcriptmus308-RA
Protein status:BO28634.pep: Imported from assembly
Sequenced Size:6211

Clone Sequence Records

BO28634.complete Sequence

6211 bp assembled on 2011-07-28

GenBank Submission: KX794159

> BO28634.complete
GAAGTTATCAGTCGACATGGCATTCTCGCAGTCGTTCAACTTCGGAAACA
GCACCTTAATGGCGCTGGAGAAAGGAATGCAAGCGGACGACAAGGAGAAT
GCACAGCCAGGAAACGGAAATATCCAAGTCCAAAGTGCCGGCAATGAGGT
AAATAGCGAGATCCAGGAAATTAACTCGGAGTTTTTCCGGGACGAGTTCT
CCTACGAAGTGAATCAGGCCCATAAGCCAGCTGAACAATCAGTGGTCAAT
GTGTCTCAGGTTCAGCAGCATATGGCAGTTGTTTCCAATCAGGACTCTGA
GGATCAGAGCCGCTCATCCGCTTTGAATGACCAAATCTGCACACAGTCTT
CGTTCGAGGGCGAGGACGCAGGCGCGGATGCAGTGCTGGATCAGCCCAAT
CTGGATGAGAACAGCTTTTTGTGTCCTGCGCAGGATGAAGAGGCTTCCGA
GCAGCTGAAGGAAGACATCTTGCACAGTCATTCCGTATTGGCCAAGCAGG
AATTCTATCAAGAGATTTCGCAAGTCACGCAGAACCTGAGCAGCATGTCG
CCCAACCAACTGCGAGTGTCGCCCAACTCCTCGAGGATCCGCGAAGCGAT
GCCCGAAAGACCAGCAATGCCACTTGATCTCAACACGCTTAGATCAATAA
GCGCATGGAACCTGCCCATGAGCATTCAAGCGGAGTACAAGAAGAAGGGT
GTTGTCGATATGTTCGACTGGCAGGTGGAGTGTCTCTCCAAGCCTAGATT
GCTGTTTGAGCACTGCAACCTGGTTTATTCAGCACCCACGTCGGCAGGCA
AGACGTTGGTTAGTGAGATACTGATGCTGAAAACCGTACTGGAGCGAGGT
AAAAAGGTGCTGCTCATACTGCCCTTCATCTCGGTGGTGCGCGAGAAAAT
GTTCTACATGCAGGATCTGCTCACGCCGGCTGGTTACCGCGTGGAGGGAT
TCTACGGCGGCTATACGCCACCAGGAGGCTTTGAGAGCCTTCATGTGGCC
ATTTGCACAATTGAGAAGGCGAACTCCATTGTGAACAAGCTGATGGAGCA
GGGCAAACTGGAAACCATTGGCATGGTGGTGGTAGACGAAGTGCATCTCA
TTTCGGACAAGGGACGCGGCTATATCCTGGAACTTCTGCTAGCCAAGATC
CTCTACATGTCCCGTCGCAATGGACTGCAGATCCAGGTGATCACCATGTC
GGCCACACTCGAGAATGTGCAGCTGCTGCAGAGCTGGCTTGACGCCGAGT
TGTACATCACAAACTACCGACCCGTTGCTCTAAAGGAAATGATTAAGGTG
GGCACAGTAATTTATGACCACCGTTTGAAATTAGTTCGAGATGTGGCCAA
GCAAAAGGTACTTTTGAAAGGCCTGGAAAACGATTCCGATGATGTGGCCC
TTCTCTGCATAGAGACGTTGCTGGAGGGATGCTCGGTAATCGTGTTCTGC
CCCTCGAAAGATTGGTGCGAGAACCTGGCCGTTCAATTGGCCACCGCAAT
CCATGTCCAAATCAAATCTGAAACAGTGCTGGGCCAGCGATTGAGAACAA
ATCTAAATCCGAGGGCCATTGCAGAAGTGAAGCAACAACTCAGGGACATT
CCCACAGGTCTCGATGGGGTCATGTCGAAGGCGATCACCTACGCCTGCGC
GTTTCACCACGCCGGCCTAACTACGGAGGAGCGGGACATTATTGAAGCCT
CGTTTAAGGCAGGAGCACTGAAGGTTCTAGTCGCCACCAGCACACTGAGT
TCGGGAGTGAATCTGCCCGCTCGGCGCGTCCTGATACGCTCGCCATTATT
TGGGGGCAAGCAAATGAGTTCCCTAACGTACCGCCAGATGATCGGACGAG
CTGGACGCATGGGAAAGGATACGCTGGGTGAGTCTATTCTCATCTGCAAC
GAGATCAATGCCCGAATGGGAAGAGACCTGGTCGTATCGGAGCTGCAGCC
CATTACTTCCTGCCTCGATATGGACGGAAGCACCCACTTGAAGCGCGCTC
TACTCGAGGTAATTTCTTCTGGTGTAGCGAACACCAAAGAAGACATCGAC
TTCTTCGTGAATTGTACTCTGCTGAGTGCCCAAAAGGCCTTCCACGCAAA
GGAGAAACCACCCGATGAGGAATCGGACGCCAACTACATTAACGATGCCC
TCGACTTTCTTGTGGAGTACGAGTTCGTTCGCCTGCAAAGGAACGAGGAA
AGGGAGACAGCGGTCTATGTGGCCACTCGTCTCGGTGCCGCCTGTCTGGC
TTCCTCTATGCCGCCCACCGACGGCCTCATTCTTTTTGCGGAACTCCAGA
AATCTCGTCGCTCCTTCGTCCTAGAGTCAGAACTGCATGCTGTTTACCTA
GTAACGCCCTATTCTGTCTGCTACCAACTTCAAGATATCGACTGGCTGCT
GTATGTGCATATGTGGGAAAAGTTAAGTTCGCCCATGAAAAAAGTGGGCG
AGCTTGTTGGAGTCAGGGACGCCTTTCTCTACAAAGCGCTGCGTGGTCAA
ACAAAACTAGACTACAAGCAAATGCAAATACATAAGCGTTTCTACATAGC
TCTGGCTCTGGAGGAACTGGTAAACGAAACACCCATAAACGTCGTGGTCC
ACAAGTATAAGTGCCACCGAGGAATGCTACAGAGTCTGCAGCAAATGGCC
TCGACCTTTGCAGGCATTGTTACTGCTTTCTGCAATTCTCTGCAGTGGTC
CACACTCGCCCTGATCGTGTCCCAATTTAAGGATCGTCTCTTCTTTGGCA
TTCACAGGGATCTTATCGATCTGATGCGAATACCCGATCTGTCGCAGAAA
CGAGCTCGTGCTCTCTTTGATGCTGGCATCACCAGTTTGGTAGAGCTAGC
GGGCGCTGATCCCGTAGAATTGGAAAAGGTGCTCTATAACTCAATCAGCT
TCGACTCTGCAAAGCAACACGACCACGAGAACGCGGATGAAGCGGCCAAG
CGAAATGTAGTTAGAAATTTCTATATCACAGGCAAGGCGGGGATGACAGT
GAGCGAGGCTGCCAAACTACTGATTGGTGAAGCTCGACAATTTGTTCAGC
ACGAGATCGGACTGGGCACAATTAAATGGACCCAAACTCAGGCGGGAGTG
GAAATAGCTTCGAGGGCAATACACGATGGCGGGGAGGTAGACCTCCACAT
GTCCCTGGAGGAGGAGCAGCCGCCAGTAAAGAGGAAATTGTCCATCGAAG
AAAATGGCACAGCCAATTCACAAAAAAATCCCAGACTCGAAACAGTAGTG
GACACACAGCGAGGCTATAAAGTTGATAAGAATATTGCTAATCAAAGCAA
GATGAACCCGAATCTTAAAGAAATCGATGCCCAAAATAAGGCGCGAAGGA
ATTCAACTGCACACATGGATAACCTAAACCCGATTAGCAATGACCCTTGT
CAGAACAACGTAAACGTAAAAACGGCACAACCCATAATATCCAATTTGAA
TGACATCCAGAAACAAGGTTCTCAGATTGAAAAGATGAAAATCAATCCAG
CAACTGTGGTGTGTAGTCCACAATTAGCAAATGAAGAAAAACCGAGTACC
AGTCAAAGTGCTAGAAGGAAGCTCGTTAATGAGGGAATGGCCGAACGCCG
CAGGGTCGCTTTAATGAAGATTCAGCAACGCACCCAAAAAGAGAACCAGT
CTAAGGATCAGCCAATACAGGCGTCGAGGTCTAACCAACTTTCAAGTCCG
GTTAATAGAACACCCGCAAATCGATGGACACAATCGGAAAACCCAAACAA
TGAGATGAACAATAGTCAACTGCCCCGCAGAAATCCACGAAATCAATCAC
CAGTACCCAATGCAAACCGCACTGCGTCAAGGAAGGTTTCCAACGCAGAG
GAGGATTTGTTTATGGCAGACGATTCCTTTATGCTGAATACCGGTCTAGC
CGCTGCTCTCACGGCCGCTGAGAGCAAAATTGCCTCTTGCACGGAGGCGG
ACGTGATACCTAGCTCGCAACCTAAGGAGCCGGAAGTGATCGGTGCACTG
ACTCCACATGCATCCAGACTGAAGCGTTCCGACCAGTTGCGTTCACAGCG
CATACAAAGTCCCAGCCCCACCCCGCAACGTGAAATCGAAATTGATTTGG
AATCGAAAAACGAATCCAATGGGGTCTCCTCTATGGAAATCTCGGACATG
TCTATGGAGAACCCACTCATGAAAAATCCTTTACATCTAAATGCCTCGCA
CATTATGAGCTGTTCGAAAGTCGATGAAACTGCGTCGAGTTTCTCTTCTA
TAGATATAATCGATGTGTGTGGCCACCGGAATGCGTTTCAAGCTGCTATC
ATCGAGATCAATAACGCCACGCGTTTGGGATTTAGCGTTGGCCTGCAGGC
TCAAGCGGGCAAACAGAAGCCGCTAATTGGATCCAACCTCTTGATCAATC
AAGTTGCGGCGGCCGAGAACCGGGAGGCGGCTGCCAGGGAACGTGTGCTA
TTCCAAGTGGACGACACCAACTTCATCTCTGGTGTGTCTTTCTGTCTTGC
GGACAATGTTGCCTACTATTGGAATATGCAAATTGACGAACGTGCAGCAT
ATCAGGGAGTGCCCACCCCTCTCAAGGTGCAGGAATTGTGCAACCTGATG
GCTCGAAAGGATCTCACGCTGGTCATGCACGACGGAAAGGAGCAGCTTAA
GATGCTGCGCAAAGCGATTCCGCAGCTAAAAAGGATTAGCGCCAAGCTGG
AGGATGCCAAGGTCGCAAACTGGCTGCTGCAGCCGGACAAAACTGTGAAT
TTTCTCAATATGTGCCAGACATTCGCCCCGGAATGCACTGGCCTTGCGAA
TCTCTGTGGCAGTGGTCGTGGTTATAGCAGCTACGGGCTTGATACCTCCA
GTGCCATTTTGCCGAGGATTAGGACGGCCATCGAATCCTGCGTAACGCTG
CACATACTCCAGGGACAGACTGAGAACCTAAGCAGGATTGGCAATGGTGA
CTTACTTAAGTTTTTCCACGATATCGAAATGCCCATTCAATTGACTCTTT
GTCAAATGGAGCTTGTGGGCTTTCCCGCCCAGAAGCAGCGACTCCAACAG
CTTTATCAGCGCATGGTGGCCGTTATGAAGAAAGTGGAAACAAAGATTTA
TGAGCAGCATGGTTCCCGTTTCAATCTGGGCTCGTCACAAGCTGTTGCCA
AGGTGCTGGGACTCCACCGGAAAGCAAAAGGACGAGTTACCACCTCACGC
CAGGTGCTGGAGAAGTTGAACTCGCCCATTTCGCATTTGATACTAGGCTA
TCGAAAGCTGTCTGGGCTCTTGGCCAAAAGCATTCAGCCGCTAATGGAGT
GCTGCCAGGCAGACAGAATTCATGGCCAGAGCATTACATATACGGCAACG
GGTCGTATTTCCATGACGGAGCCGAACCTGCAAAATGTCGCCAAAGAATT
CAGCATACAAGTGGGCTCTGATGTGGTCCACATATCCTGTAGGTCACCAT
TCATGCCCACGGATGAGAGCCGATGTCTTTTGTCGGCTGACTTCTGTCAG
CTGGAGATGCGGATCCTTGCCCACATGTCTCAGGATAAGGCTCTGTTGGA
GGTGATGAAATCGTCACAGGACCTGTTCATCGCAATTGCAGCGCATTGGA
ACAAAATCGAAGAGTCCGAAGTGACGCAGGACCTCCGCAACAGCACCAAG
CAGGTGTGCTACGGAATCGTCTACGGCATGGGCATGCGGTCCCTGGCCGA
GTCGTTAAACTGCAGTGAGCAGGAGGCGCGGATGATATCCGATCAGTTTC
ACCAGGCGTACAAGGGTATTCGCGATTACACCACGAGGGTGGTCAATTTC
GCACGCAGCAAGGGATTTGTTGAGACCATTACTGGACGGCGACGGTATTT
GGAAAATATCAACAGTGATGTGGAGCATCTAAAAAATCAGGCCGAGCGCC
AGGCCGTTAACTCCACCATCCAAGGATCGGCTGCGGATATTGCGAAGAAC
GCTATTCTGAAGATGGAAAAGAACATTGAACGTTATCGCGAAAAGCTGGC
ATTGGGTGACAATTCAGTTGACCTGGTAATGCACCTACATGACGAACTCA
TTTTCGAGGTGCCAACGGGAAAGGCCAAAAAAATAGCCAAAGTCCTTAGC
CTCACCATGGAGAACTGCGTGAAACTCAGCGTGCCACTCAAGGTGAAGCT
GAGGATCGGACGCAGTTGGGGTGAATTTAAGGAAGTTAGCGTGGCAAGCT
TTCTAGACCAT

BO28634.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 22:20:02
Subject Length Description Subject Range Query Range Score Percent Strand
mus308-RA 6180 CG6019-PA 1..6177 17..6193 30885 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:20:03
Subject Length Description Subject Range Query Range Score Percent Strand
mus308-RA 6420 CG6019-RA 93..6269 17..6193 30885 100 Plus
CG12279-RA 601 CG12279-RA 457..601 6193..6049 725 100 Minus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 22:19:59
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 12707282..12709506 4762..2538 11125 100 Minus
3R 32079331 3R 12710615..12712207 1609..17 7965 100 Minus
3R 32079331 3R 12706048..12706963 5885..4970 4580 100 Minus
3R 32079331 3R 12709565..12710121 2538..1982 2785 100 Minus
3R 32079331 3R 12710176..12710551 1981..1606 1880 100 Minus
3R 32079331 3R 12705674..12705981 6193..5886 1540 100 Minus
3R 32079331 3R 12707021..12707229 4970..4762 1045 100 Minus
Blast to na_te.dros performed on 2014-11-26 22:20:01 has no hits.

BO28634.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-07-28 13:15:07 Download gff for BO28634.complete
Subject Subject Range Query Range Percent Splice Strand
mus308-RA 93..6269 17..6195 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 03:54:34 Download gff for BO28634.complete
Subject Subject Range Query Range Percent Splice Strand
mus308-RA 93..6269 17..6195 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:57:54 Download gff for BO28634.complete
Subject Subject Range Query Range Percent Splice Strand
mus308-RA 93..6269 17..6195 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 22:57:54 Download gff for BO28634.complete
Subject Subject Range Query Range Percent Splice Strand
3R 12710617..12712207 17..1607 100   Minus
3R 12710176..12710549 1608..1981 100 <- Minus
3R 12709565..12710121 1982..2538 100 <- Minus
3R 12707282..12709505 2539..4762 100 <- Minus
3R 12707021..12707228 4763..4970 100 <- Minus
3R 12706048..12706962 4971..5885 100 <- Minus
3R 12705672..12705981 5886..6195 99 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 03:54:34 Download gff for BO28634.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 8536339..8537929 17..1607 100   Minus
arm_3R 8535898..8536271 1608..1981 100 <- Minus
arm_3R 8535287..8535843 1982..2538 100 <- Minus
arm_3R 8533004..8535227 2539..4762 100 <- Minus
arm_3R 8532743..8532950 4763..4970 100 <- Minus
arm_3R 8531770..8532684 4971..5885 100 <- Minus
arm_3R 8531394..8531703 5886..6195 99 <- Minus

BO28634.pep Sequence

Translation from 16 to 6211

> BO28634.pep
MAFSQSFNFGNSTLMALEKGMQADDKENAQPGNGNIQVQSAGNEVNSEIQ
EINSEFFRDEFSYEVNQAHKPAEQSVVNVSQVQQHMAVVSNQDSEDQSRS
SALNDQICTQSSFEGEDAGADAVLDQPNLDENSFLCPAQDEEASEQLKED
ILHSHSVLAKQEFYQEISQVTQNLSSMSPNQLRVSPNSSRIREAMPERPA
MPLDLNTLRSISAWNLPMSIQAEYKKKGVVDMFDWQVECLSKPRLLFEHC
NLVYSAPTSAGKTLVSEILMLKTVLERGKKVLLILPFISVVREKMFYMQD
LLTPAGYRVEGFYGGYTPPGGFESLHVAICTIEKANSIVNKLMEQGKLET
IGMVVVDEVHLISDKGRGYILELLLAKILYMSRRNGLQIQVITMSATLEN
VQLLQSWLDAELYITNYRPVALKEMIKVGTVIYDHRLKLVRDVAKQKVLL
KGLENDSDDVALLCIETLLEGCSVIVFCPSKDWCENLAVQLATAIHVQIK
SETVLGQRLRTNLNPRAIAEVKQQLRDIPTGLDGVMSKAITYACAFHHAG
LTTEERDIIEASFKAGALKVLVATSTLSSGVNLPARRVLIRSPLFGGKQM
SSLTYRQMIGRAGRMGKDTLGESILICNEINARMGRDLVVSELQPITSCL
DMDGSTHLKRALLEVISSGVANTKEDIDFFVNCTLLSAQKAFHAKEKPPD
EESDANYINDALDFLVEYEFVRLQRNEERETAVYVATRLGAACLASSMPP
TDGLILFAELQKSRRSFVLESELHAVYLVTPYSVCYQLQDIDWLLYVHMW
EKLSSPMKKVGELVGVRDAFLYKALRGQTKLDYKQMQIHKRFYIALALEE
LVNETPINVVVHKYKCHRGMLQSLQQMASTFAGIVTAFCNSLQWSTLALI
VSQFKDRLFFGIHRDLIDLMRIPDLSQKRARALFDAGITSLVELAGADPV
ELEKVLYNSISFDSAKQHDHENADEAAKRNVVRNFYITGKAGMTVSEAAK
LLIGEARQFVQHEIGLGTIKWTQTQAGVEIASRAIHDGGEVDLHMSLEEE
QPPVKRKLSIEENGTANSQKNPRLETVVDTQRGYKVDKNIANQSKMNPNL
KEIDAQNKARRNSTAHMDNLNPISNDPCQNNVNVKTAQPIISNLNDIQKQ
GSQIEKMKINPATVVCSPQLANEEKPSTSQSARRKLVNEGMAERRRVALM
KIQQRTQKENQSKDQPIQASRSNQLSSPVNRTPANRWTQSENPNNEMNNS
QLPRRNPRNQSPVPNANRTASRKVSNAEEDLFMADDSFMLNTGLAAALTA
AESKIASCTEADVIPSSQPKEPEVIGALTPHASRLKRSDQLRSQRIQSPS
PTPQREIEIDLESKNESNGVSSMEISDMSMENPLMKNPLHLNASHIMSCS
KVDETASSFSSIDIIDVCGHRNAFQAAIIEINNATRLGFSVGLQAQAGKQ
KPLIGSNLLINQVAAAENREAAARERVLFQVDDTNFISGVSFCLADNVAY
YWNMQIDERAAYQGVPTPLKVQELCNLMARKDLTLVMHDGKEQLKMLRKA
IPQLKRISAKLEDAKVANWLLQPDKTVNFLNMCQTFAPECTGLANLCGSG
RGYSSYGLDTSSAILPRIRTAIESCVTLHILQGQTENLSRIGNGDLLKFF
HDIEMPIQLTLCQMELVGFPAQKQRLQQLYQRMVAVMKKVETKIYEQHGS
RFNLGSSQAVAKVLGLHRKAKGRVTTSRQVLEKLNSPISHLILGYRKLSG
LLAKSIQPLMECCQADRIHGQSITYTATGRISMTEPNLQNVAKEFSIQVG
SDVVHISCRSPFMPTDESRCLLSADFCQLEMRILAHMSQDKALLEVMKSS
QDLFIAIAAHWNKIEESEVTQDLRNSTKQVCYGIVYGMGMRSLAESLNCS
EQEARMISDQFHQAYKGIRDYTTRVVNFARSKGFVETITGRRRYLENINS
DVEHLKNQAERQAVNSTIQGSAADIAKNAILKMEKNIERYREKLALGDNS
VDLVMHLHDELIFEVPTGKAKKIAKVLSLTMENCVKLSVPLKVKLRIGRS
WGEFKEVSVASFLDH

BO28634.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 07:07:16
Subject Length Description Subject Range Query Range Score Percent Strand
mus308-PA 2059 CG6019-PA 1..2059 1..2059 10452 100 Plus
mus301-PA 1051 CG7972-PA 99..1008 66..956 820 28.5 Plus
l(3)72Ab-PA 2142 CG5931-PA 498..891 251..648 307 27.4 Plus
CG5205-PA 2183 CG5205-PA 1354..1718 251..629 287 25.6 Plus
l(2)35Df-PA 1055 CG4152-PA 168..596 251..667 270 25.9 Plus
CG5205-PA 2183 CG5205-PA 504..877 251..626 232 24.8 Plus