Clone BO28635 Report

Search the DGRC for BO28635

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:286
Well:35
Vector:pDNR-Dual
Associated Gene/Transcriptdrpr-RA
Protein status:BO28635.pep: Imported from assembly
Sequenced Size:1816

Clone Sequence Records

BO28635.complete Sequence

1816 bp assembled on 2011-07-13

GenBank Submission: KX800030

> BO28635.complete
GAAGTTATCAGTCGACATGTTGCCGGTAATCCTCATAGCCTGCCTGGCCC
AGCTGGTACTGGCTCAGGCGGATCTTAAAGATCTGGATGGACCCAATATC
TGCAAAAGAAGAGAACTATATAACGTAGACGTTGTCTACACAGAACTGCA
ATCGTTCCAGGAACGGGGCTCCACCTGGTGCGTCACATTCCCGCCGAGGT
GCTCCACCTATCGCATTAAACACCGAGTGGTCAACAAAACCAAGACGATT
GCAAAGAACCGTATTGTGAGGGACTGTTGTGATGGCTACATCGCGAGCGC
AGGAGAATGCGTGCCGCATTGTTCGGAACCCTGCCAGCACGGTAGATGCA
TCTCCCCGGAGAAGTGCAAGTGTGATCATGGTTACGGAGGACCCGCCTGC
GATATAATTTGCAGATGCCTGAATAACTCCTCCTGCGACCCCGATTCCGG
TAACTGCATCTGCTCAGCCGGTTGGACTGGCGCCGACTGTGCGGAACCCT
GCCCACCTGGATTCTACGGCATGGAATGCAAGGAACGGTGCCCGGAGATC
CTCCATGGCAACAAGAGCTGCGATCACATCACAGGTGAAATTCTCTGCCG
CACGGGTTACATAGGTCTCACCTGCGAGCACCCATGTCCTGCTGGACTCT
ACGGACCCGGCTGCAAGCTCAAGTGCAATTGCGAGCACGGCGGCGAGTGC
AACCACGTTACAGGCCAGTGCCAGTGCCTGCCAGGGTGGACAGGTTCCAA
CTGCAACGAGTCCTGTCCCACAGACACCTACGGACAAGGATGCGCCCAGC
GGTGCCGCTGCGTGCACCACAAGGTTTGCCGCAAGGCCGACGGTATGTGC
ATCTGCGAAACCGGCTGGTCGGGCACCCGGTGCGATGAGGTCTGTCCGGA
GGGATTCTACGGCGAGCACTGCATGAATACCTGTGCCTGTCCGTCGGCCA
ATTTCCAGTGCCATGCGGCCCACGGTTGTGTGTGCAGGAGTGGCTACACC
GGCGATAACTGCGACGAGCTAATCGCCTCTCAACGTATTGCAGACCAAAG
CGAAAATTCGAGCCGGGCGAGTGTAGCTCTGACCTTAGTCCTGATGACCC
TGTTTGCGTGCATAATCTTCGCAGTGTTCATTTACTACCGCCGACGTGTG
TCCAATCTAAAAACCGAAATCGCCCATGTACACTACACCCATGATACGAA
TCCCCCGAGCTGGCCGCCCAACCACAACTTCGACAATCCCGTGTACGGCA
TGCAGGCGGAAACGCGTCTCCTGCCCAACAATATGCGTTCCAAGATGAAC
AACTTTGACCAGAGGAGCACGATGAGCACGGACTACGGCGATGACTGCAA
TGCCAGTGGCAGGGTGGGTAGCTATTCGATCAACTACAACCACGACCTGC
TAACGAAGAACTTGAACGCGGACCGGACCAATCCGATTGTGTACAACGAA
TCCCTCAAAGAGGAGCATGTCTACGACGAGATCAAGCACAAGGAGGGCTA
CAAGGATCCCGTGAAAATATATAGCAAGATTTTGTTTCCCGAGGATGAAT
ACGATCACCTGGACTACTCACGACCCAGCACCTCGCAGAAGCCGCACTAC
CACCGCATGAACGACGCCATGCTCAACATCAACCAGGACGAGGAGAAGCC
CAGCAACGTGAAGAACATGACTGTGCTGCTGAACAAACCGCTGCCGCCCA
CGGAACCGGAGCCACAACACGAGTGCTTCGACAACACGAACACCAACCTG
GACAACGTGTCGACGGCGTCGCCTAGTTCCAGTCCGAAATTTCTAAAGGC
AAGCTTTCTAGACCAT

BO28635.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:34:36
Subject Length Description Subject Range Query Range Score Percent Strand
drpr-RA 1785 CG2086-PA 1..1782 17..1798 8910 100 Plus
drpr-RC 1587 CG2086-PC 1..1495 17..1511 7475 100 Plus
drpr-RE 3129 CG2086-PE 1729..3126 401..1798 6960 99.9 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:34:37
Subject Length Description Subject Range Query Range Score Percent Strand
drpr-RA 3206 CG2086-RA 716..2498 16..1798 8915 100 Plus
drpr-RC 3298 CG2086-RC 716..2211 16..1511 7480 100 Plus
drpr-RE 4435 CG2086-RE 2445..3842 401..1798 6960 99.9 Plus
drpr-RC 3298 CG2086-RC 2451..2705 1544..1798 1275 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 21:34:34
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 1717379..1717880 1058..557 2510 100 Minus
3L 28110227 3L 1717003..1717308 1364..1059 1530 100 Minus
3L 28110227 3L 1716303..1716557 1798..1544 1275 100 Minus
3L 28110227 3L 1723770..1723933 281..118 820 100 Minus
3L 28110227 3L 1717946..1718103 558..401 760 98.7 Minus
3L 28110227 3L 1716797..1716944 1511..1364 740 100 Minus
3L 28110227 3L 1723580..1723706 407..281 635 100 Minus
3L 28110227 3L 1723992..1724093 117..16 510 100 Minus
Blast to na_te.dros performed on 2014-11-26 21:34:35 has no hits.

BO28635.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-07-13 13:15:56 Download gff for BO28635.complete
Subject Subject Range Query Range Percent Splice Strand
drpr-RA 708..2484 22..1800 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 03:30:38 Download gff for BO28635.complete
Subject Subject Range Query Range Percent Splice Strand
drpr-RA 722..2498 22..1800 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:36:51 Download gff for BO28635.complete
Subject Subject Range Query Range Percent Splice Strand
drpr-RA 722..2498 22..1800 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 22:36:51 Download gff for BO28635.complete
Subject Subject Range Query Range Percent Splice Strand
3L 1723992..1724087 22..117 100   Minus
3L 1723770..1723933 118..281 100 <- Minus
3L 1723580..1723705 282..407 100 <- Minus
3L 1717947..1718096 408..557 100 <- Minus
3L 1717379..1717879 558..1058 100 <- Minus
3L 1717003..1717308 1059..1364 100 <- Minus
3L 1716797..1716943 1365..1511 100 <- Minus
3L 1716675..1716707 1512..1544 100 <- Minus
3L 1716301..1716556 1545..1800 99 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 03:30:38 Download gff for BO28635.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 1723992..1724087 22..117 100   Minus
arm_3L 1723770..1723933 118..281 100 <- Minus
arm_3L 1723580..1723705 282..407 100 <- Minus
arm_3L 1717947..1718096 408..557 100 <- Minus
arm_3L 1717379..1717879 558..1058 100 <- Minus
arm_3L 1717003..1717308 1059..1364 100 <- Minus
arm_3L 1716797..1716943 1365..1511 100 <- Minus
arm_3L 1716675..1716707 1512..1544 100 <- Minus
arm_3L 1716301..1716556 1545..1800 99 <- Minus

BO28635.pep Sequence

Translation from 16 to 1816

> BO28635.pep
MLPVILIACLAQLVLAQADLKDLDGPNICKRRELYNVDVVYTELQSFQER
GSTWCVTFPPRCSTYRIKHRVVNKTKTIAKNRIVRDCCDGYIASAGECVP
HCSEPCQHGRCISPEKCKCDHGYGGPACDIICRCLNNSSCDPDSGNCICS
AGWTGADCAEPCPPGFYGMECKERCPEILHGNKSCDHITGEILCRTGYIG
LTCEHPCPAGLYGPGCKLKCNCEHGGECNHVTGQCQCLPGWTGSNCNESC
PTDTYGQGCAQRCRCVHHKVCRKADGMCICETGWSGTRCDEVCPEGFYGE
HCMNTCACPSANFQCHAAHGCVCRSGYTGDNCDELIASQRIADQSENSSR
ASVALTLVLMTLFACIIFAVFIYYRRRVSNLKTEIAHVHYTHDTNPPSWP
PNHNFDNPVYGMQAETRLLPNNMRSKMNNFDQRSTMSTDYGDDCNASGRV
GSYSINYNHDLLTKNLNADRTNPIVYNESLKEEHVYDEIKHKEGYKDPVK
IYSKILFPEDEYDHLDYSRPSTSQKPHYHRMNDAMLNINQDEEKPSNVKN
MTVLLNKPLPPTEPEPQHECFDNTNTNLDNVSTASPSSSPKFLKASFLDH

BO28635.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 06:57:16
Subject Length Description Subject Range Query Range Score Percent Strand
drpr-PA 594 CG2086-PA 1..594 1..594 3379 100 Plus
drpr-PD 613 CG2086-PD 1..613 1..594 3348 96.7 Plus
drpr-PC 528 CG2086-PC 1..498 1..498 2860 100 Plus
drpr-PE 1042 CG2086-PE 521..1042 61..594 2698 90.3 Plus
drpr-PB 1031 CG2086-PB 521..1031 61..594 2621 88.2 Plus
drpr-PE 1042 CG2086-PE 1..347 1..336 1211 62.3 Plus
drpr-PE 1042 CG2086-PE 274..519 98..333 528 38.1 Plus