Clone BO28637 Report

Search the DGRC for BO28637

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:286
Well:37
Vector:pDNR-Dual
Associated Gene/TranscriptCG17386-RA
Protein status:BO28637.pep: Imported from assembly
Sequenced Size:2635

Clone Sequence Records

BO28637.complete Sequence

2635 bp assembled on 2011-08-04

GenBank Submission: KX795865

> BO28637.complete
GAAGTTATCAGTCGACATGAGCAGTCCCAGGGATAAGGCGGAGCAGGTGT
ACGAGGTGAAGGCTCCACATGCCGGTGCAGAGGGTCACACGTTCCTTGTG
AGTCCCGTGGACCCCACTCCGATCCTAGCGCCCATTCTCACCGCTGTGCC
TGTGATGAAAGCACCGGATTCGCCTGCTTCAATGGACAAGACCAAGGAGA
TGGAGGAGCTGGATGATGAGCAGCCGAGCTGCAGTTCCCAGGCGGTGGTG
CCGTTGTCCTCATCGCTGCCCTGCAAGCTGCTCCGCATGCATGCCAGACG
CTCGGCCCAGGCGCTGCTCCACCAAATGGAATCGATGGACTCTCAGCTGG
GCAGCAGCAATGGCAGCACCTCGGAGGATACTTCACCCTCTGCTCCGCCC
ATGTCGCCCACTGACCACCAACTGGTGGATGTGGGCATGGGTTCCTCCAT
TGGGGACTCGGATGAATCGTCGGAAGAGGGTGATGAGCTGAAGCCCCTGG
CCGTGGACAATCACATCATAGCCGAGGTGGACCTAACCGAGCGCCAGACT
ACGCCACCGGCCGTCTTGAGTGAGGCGAATTTGGAGAAGTTCCGTAAGCA
CCAGATGGATAACATCTATCTACATCCTAACTTCACTCTGGATGCTTCTC
CACCTCCGGCGGTCGCACCAGCCAACTCACCCGTTCTGGAGGCCAAGAGA
ACCCATCGTTCGTTCCTCACCATGAAGAAGGAAAAGGAGGTGGAGCCGCC
GCAAGAGAAGGAGCAGGAAGTGCCGGTACACCAGGAACAGGATACTGAGC
CCCAAGGACCCAATGAGATAGACACACTAGATCCCTCACTCATTCCCAGC
GAGGAACTGGCAGCCGAAATCACCGATGCCGTGGAGTTCTACTTCTCCAA
TGAGAGCATCCTGAAGGATGCATTCCTGCTGAAACATGTGCGACGCAACA
AGGAGGGTTTCGTCAGCCTTAAACTGGTGTCCAGCTTCAAGAGGGTGCGC
CAACTGACCAGGGAGTGGAAGGTGGTTGGAGATGCAGTGCGTCGCAAGTC
CCGCAAGATCGAGCTGAATGATGTGGGCACCAAGGTGCGCAGAATCGAAC
CGCTGCCCAGTTTCGATGAAACCATGCCCTCTCGCACGATCGTTGCCTGT
GATCTGCCACTGGACAAGCTAACCATCGAAAAGGTATCGGATCTATTCTC
GCCATGCGGAGAGATTGCCCTCATACGCATTCTCAAGCCCGGAATGGCCA
TTCCCGTGGATGTGCGTCAGTTCATGAACAAGTATCCAGAACTGCAGCAA
AAGGAGTGTGCTCTAGTGGAGTACTTAGAATCCTCTTCCGCCAGGGATGC
CCGTCATCTGAATGGCCCCTTTCAGGTCTACGAGATGGTGGCGCCCAAGA
AAAAGACCGGCAAGAAGGCAGCCGTCATCCAGATCGCCGCTCCGGTGGCC
CGGATGGTGGAGAATTATCGCTACTACAACGATGCCAACTACGAGCGGAG
TCGAGGTGGCAGCTTCTCCGGCCACGAAACTGTACCGGATCTGCGCTTCA
AACTCAAGCGCAACAACTCGGACTTCCAGCCCAGTTACTACCAACAAACG
GGGCCCAGCTACCATGCCAATCCGTATCAGCATTATCAGCCCCGTGGGAG
CATTGGCAACCAGAACCAGGAGGTGGGTCCCAATGGTTTTTTCGGCTATG
GTCCCAGGCGATACAGCAACACATCGACAATTTCGGCCAACACAGCGGCC
GCCTTGGGCGATGTTTCGCCTATATCTTCTGCTGTCAATTCAGGCGGTAA
TCCGATGGTGTCTGGTATAAGCAGTCTGCAGCGCCGTCTGTCCAACTGCT
CCGAGCAGAACTACACTCCAGAAGTCAATCCTTCGATGTCACGAAGGGCC
AGCAATTGCTCGGAAACGGGAGGAGTTCCCCAACGTCGCGATTCGAACTG
TTCGGAGAGTTGTCCATGCTCCCGAAGGGTCTCGGACTTTGCTCAGACGA
CAGACACTAGTTACAGAAAGACCTCGGTGTGTTCGAATGGCAGCTGTCCG
GGCAATAATCAGAACCAGGAGCGTCGCTTCTCCAACGGATCCATGCAGTT
CGAGCGAACCTTCTCGAATGCCAGCGAGAGCAGTGGCTTCTATCGTCGCC
CGTCGAACGATTTCAATATCGAGCGGGAGCCCATCCAAACCGATCAGCTG
GTGGGTGGAGGAGGCGGTGGCTACCAGGTGTGGCCACGTCGTTACTCCAA
CAACTTCCAGCAGCTGAGCAGCAAGCTGGCGGCATATGATAATGCTCAGT
ATATCGGAGGAAGACGTATATCCACGGACTCGGGATACGATCGTCGCTGC
TCGTTTGGATCGGAAGGCTTCGAAGGATCTCCACGATCTCGCACCGGTAG
CTTCCTGAGCAACTACAAGCACGGCGGCGGCGATGGCTACGATGGCCAGC
CAAGATCCCGAACCGGTAGCTTCCTCGACGGATCTCCTCGGTCGCGTTCC
GGTTCGTTTGCCCAGCGAGCTGCCGAGAGCCTGGTGCGCACTCCAATGGG
TCCAGATGGTAGCAAGGGATTCGGCCAGAGGGCCAGGAAATTCGGACAGA
CCATATCGCCCGTAAATGCAAGCTTTCTAGACCAT

BO28637.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 01:09:42
Subject Length Description Subject Range Query Range Score Percent Strand
CG17386-RB 2604 CG17386-PB 1..2601 17..2617 13005 100 Plus
CG17386-RA 2604 CG17386-PA 1..2601 17..2617 13005 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 01:09:43
Subject Length Description Subject Range Query Range Score Percent Strand
CG17386-RB 4441 CG17386-RB 715..3316 16..2617 13010 100 Plus
CG17386-RA 4271 CG17386-RA 715..3316 16..2617 13010 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 01:09:40
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 14421038..14423639 16..2617 13010 100 Plus
Blast to na_te.dros performed on 2014-11-27 01:09:41 has no hits.

BO28637.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-08-04 17:43:44 Download gff for BO28637.complete
Subject Subject Range Query Range Percent Splice Strand
CG17386-RA 699..3299 17..2619 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 04:46:43 Download gff for BO28637.complete
Subject Subject Range Query Range Percent Splice Strand
CG17386-RA 716..3316 17..2619 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 02:19:45 Download gff for BO28637.complete
Subject Subject Range Query Range Percent Splice Strand
CG17386-RA 716..3316 17..2619 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 02:19:45 Download gff for BO28637.complete
Subject Subject Range Query Range Percent Splice Strand
2R 14421039..14423639 17..2619 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 04:46:43 Download gff for BO28637.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 10308544..10311144 17..2619 99   Plus

BO28637.pep Sequence

Translation from 16 to 2635

> BO28637.pep
MSSPRDKAEQVYEVKAPHAGAEGHTFLVSPVDPTPILAPILTAVPVMKAP
DSPASMDKTKEMEELDDEQPSCSSQAVVPLSSSLPCKLLRMHARRSAQAL
LHQMESMDSQLGSSNGSTSEDTSPSAPPMSPTDHQLVDVGMGSSIGDSDE
SSEEGDELKPLAVDNHIIAEVDLTERQTTPPAVLSEANLEKFRKHQMDNI
YLHPNFTLDASPPPAVAPANSPVLEAKRTHRSFLTMKKEKEVEPPQEKEQ
EVPVHQEQDTEPQGPNEIDTLDPSLIPSEELAAEITDAVEFYFSNESILK
DAFLLKHVRRNKEGFVSLKLVSSFKRVRQLTREWKVVGDAVRRKSRKIEL
NDVGTKVRRIEPLPSFDETMPSRTIVACDLPLDKLTIEKVSDLFSPCGEI
ALIRILKPGMAIPVDVRQFMNKYPELQQKECALVEYLESSSARDARHLNG
PFQVYEMVAPKKKTGKKAAVIQIAAPVARMVENYRYYNDANYERSRGGSF
SGHETVPDLRFKLKRNNSDFQPSYYQQTGPSYHANPYQHYQPRGSIGNQN
QEVGPNGFFGYGPRRYSNTSTISANTAAALGDVSPISSAVNSGGNPMVSG
ISSLQRRLSNCSEQNYTPEVNPSMSRRASNCSETGGVPQRRDSNCSESCP
CSRRVSDFAQTTDTSYRKTSVCSNGSCPGNNQNQERRFSNGSMQFERTFS
NASESSGFYRRPSNDFNIEREPIQTDQLVGGGGGGYQVWPRRYSNNFQQL
SSKLAAYDNAQYIGGRRISTDSGYDRRCSFGSEGFEGSPRSRTGSFLSNY
KHGGGDGYDGQPRSRTGSFLDGSPRSRSGSFAQRAAESLVRTPMGPDGSK
GFGQRARKFGQTISPVNASFLDH

BO28637.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 07:14:14
Subject Length Description Subject Range Query Range Score Percent Strand
CG17386-PB 867 CG17386-PB 1..867 1..867 4523 100 Plus
CG17386-PA 867 CG17386-PA 1..867 1..867 4523 100 Plus