Clone BO28646 Report

Search the DGRC for BO28646

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:286
Well:46
Vector:pDNR-Dual
Associated Gene/TranscriptCG3808-RA
Protein status:BO28646.pep: Imported from assembly
Sequenced Size:1879

Clone Sequence Records

BO28646.complete Sequence

1879 bp assembled on 2011-08-04

GenBank Submission: KX796618

> BO28646.complete
GAAGTTATCAGTCGACATGGAGTGTTTCAATGCGGAAATACCAGCTGACG
GAGTGGTTAATAGCATAGAGACCGAAGAGATTTCGGAAAATGTAGTGAAA
GCTGATGAAACCACGCTGGCAAATGGTGAGGATGAAGCCGGAAAAGCCGG
CGAGGAATATGCTTACTTGGAGCGAAATGAATTCACTTCGGAAATATTCA
AAGTTGAAGTGAAGAACATGGGATATTTCGGTATTGGGGAGTTTAAGAAG
CTTTTGAGAAACACCCTCAAATTTGACGTGACCAAAATCAAGGCTCCAAC
TCGAAAAGAGTTCGCCTTTGTGTGCTTCCGCAGTCAGGAGGATCAACAAA
GGGCCTTGGAGATCCTGAATGGATACAAATGGAAGGGAAAGGTGTTGAAG
GCTCATGTTGCCAAGGCCTCGGCCGATCCTCTACAGAAAAAGCGAGCTGC
CGAGGAACAGGAGTCGGAGAGAAAGCCCAAGAAACAACGTACGGCGGTGG
AAGCCACGTGTCCTCTGTCGCACATTGCCTACGACCAGCAGATTAAACAA
AAATCCGAGGAAATGTCGGCACTTCTGGCGAAATACACCCAGGAACTTCG
GAAGGTCAATCCGCGGGCAAAGCCCCACTTGGATAAGTTCCAATTCCACG
AGGTGCTTCCCTCACCCACCGTTAATGGGTATAGAAATAAAAACGAGTTC
ACCGTGGGAAAGAACTCCGTAGGCGAAGTGGTTGTGGGCTTCAGATTGGG
CTGCTACAGCGATGGATCTGTGGAAGTAGCCGAGGTCGCAGACTTGCCAC
ATCTACCGGAGCAGGCCAAGTGGGCTGCTCGCAGTTTCCAGGACTTGGTG
AGGAAGTCCAAGTTCTTGCCCTTCAATCCGGACGGAAATATTGGCCACTT
CCGGCAGCTAATGGTGCGGTGCTCCAGTGCCACAGGTGAACTAATGCTGG
TGGCGGGCATATACTCCTCGAACTTAAGTGAAGACGAACAAGTTGAACTT
AAGCAAGAACTGAAGTCCTTCTACGAAGATCTGGCAAATGATGCTCCGTA
CAAATGCAGCTCTCTGTATTACCAAGATGTCAAGCATCGGGAAGCAGGTC
AGACGATTAATCCGGTGGAACACATTTCGGGCAGCACCCACATCACCGAT
ACCATACAGGGTCTCCAGTTTCGAATCAGCCCACTGGCCTTTTTCCAAAT
CAACACAGAAGGAGCCAACGTGTTGTATCAAAAGGCCATTGATCTAGTTG
CTCCTACTAAGGACACAACTATGTTGGATATTTGCTGTGGTACTGGCACC
ATTACCCTTGCGTTCGCCAAGCACTGCAAGAAAGTGATGGGCGTGGAGAT
CGTCCCTGATGCGATTAAGGATGCCGAGTTTAATGCGGAAGCGAATGGCA
TTAAAAATGCAAAGTTCTTTACAGGAAATGCAGATGATTTCATCAAGAGT
ATGGTGCGCGAAGCTCTCTACGATCAGGAGCCGGGTAAACCATTGGATCT
TATTGCCGTGGTGGATCCCCCCAGGGCTGGACTGCACCACCGCTCGATAG
CCGCAATTCGATCAGCCGATGCCATCAATCGTCTGGTCTACGTCTCCTGC
AATCCGCACAGTGCTAAGCGGAATTTCATCGAGCTGGCCAGACCGGAGTC
TAAGCAATACAAGGGGGAGCCATTCTACCCAAAGTCCGCTGTGGCCGTTG
ACATGTTTCCCCACACCATGCACACCGAGCTGGTCATTCTGTTCGAGCGT
GAACCTAAAACAAAGGCGGATGAGAAGTCATCGCCAGCGGAGGGAGCTGC
ACAGTCAAAGTCTGAGGCAACCGAAGAAGCTGTTAGCGAGGAGAACACCA
CATCCGTAACGGCAAGCTTTCTAGACCAT

BO28646.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 01:09:33
Subject Length Description Subject Range Query Range Score Percent Strand
CG3808-RA 1848 CG3808-PA 1..1845 17..1861 9225 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 01:09:34
Subject Length Description Subject Range Query Range Score Percent Strand
CG3808-RA 2522 CG3808-RA 89..1933 17..1861 9225 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 01:09:30
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 18998946..19000243 1535..238 6490 100 Minus
3L 28110227 3L 18998526..18998851 1861..1536 1630 100 Minus
3L 28110227 3L 19000298..19000520 239..17 1115 100 Minus
Blast to na_te.dros performed on 2014-11-27 01:09:32 has no hits.

BO28646.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-08-04 17:43:43 Download gff for BO28646.complete
Subject Subject Range Query Range Percent Splice Strand
CG3808-RA 89..1933 17..1863 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 04:46:38 Download gff for BO28646.complete
Subject Subject Range Query Range Percent Splice Strand
CG3808-RA 89..1933 17..1863 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 02:19:41 Download gff for BO28646.complete
Subject Subject Range Query Range Percent Splice Strand
CG3808-RA 89..1933 17..1863 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 02:19:41 Download gff for BO28646.complete
Subject Subject Range Query Range Percent Splice Strand
3L 19000299..19000520 17..238 100   Minus
3L 18998946..19000242 239..1535 100 <- Minus
3L 18998522..18998851 1536..1863 99 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 04:46:38 Download gff for BO28646.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 18993399..18993620 17..238 100   Minus
arm_3L 18992046..18993342 239..1535 100 <- Minus
arm_3L 18991622..18991951 1536..1863 99 <- Minus

BO28646.pep Sequence

Translation from 16 to 1879

> BO28646.pep
MECFNAEIPADGVVNSIETEEISENVVKADETTLANGEDEAGKAGEEYAY
LERNEFTSEIFKVEVKNMGYFGIGEFKKLLRNTLKFDVTKIKAPTRKEFA
FVCFRSQEDQQRALEILNGYKWKGKVLKAHVAKASADPLQKKRAAEEQES
ERKPKKQRTAVEATCPLSHIAYDQQIKQKSEEMSALLAKYTQELRKVNPR
AKPHLDKFQFHEVLPSPTVNGYRNKNEFTVGKNSVGEVVVGFRLGCYSDG
SVEVAEVADLPHLPEQAKWAARSFQDLVRKSKFLPFNPDGNIGHFRQLMV
RCSSATGELMLVAGIYSSNLSEDEQVELKQELKSFYEDLANDAPYKCSSL
YYQDVKHREAGQTINPVEHISGSTHITDTIQGLQFRISPLAFFQINTEGA
NVLYQKAIDLVAPTKDTTMLDICCGTGTITLAFAKHCKKVMGVEIVPDAI
KDAEFNAEANGIKNAKFFTGNADDFIKSMVREALYDQEPGKPLDLIAVVD
PPRAGLHHRSIAAIRSADAINRLVYVSCNPHSAKRNFIELARPESKQYKG
EPFYPKSAVAVDMFPHTMHTELVILFEREPKTKADEKSSPAEGAAQSKSE
ATEEAVSEENTTSVTASFLDH

BO28646.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 07:14:12
Subject Length Description Subject Range Query Range Score Percent Strand
CG3808-PA 615 CG3808-PA 1..615 1..615 3171 100 Plus