Clone BO28650 Report

Search the DGRC for BO28650

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:286
Well:50
Vector:pDNR-Dual
Associated Gene/TranscriptGtp-bp-RA
Protein status:BO28650.pep: Imported from assembly
Sequenced Size:1876

Clone Sequence Records

BO28650.complete Sequence

1876 bp assembled on 2011-07-13

GenBank Submission: KX799604

> BO28650.complete
GAAGTTATCAGTCGACATGTTGGACTTTGTGGTGATATTCACCAAGGGCG
GAGTGGTGCTGTGGCACTCGAACGCGTCCGGTAACAGTTTCGCCTCCTGC
ATCAACAGCCTGATACGTGGCGTCATTCTGGAGGAGCGCAACACAGAGGC
CAAGTACTACGAGGAGGACCACCTGGCCGTGCAGTTTAAGCTGGACAACG
AACTGGACCTGGTCTATGCGGCCATTTTCCAGAAGGTGATCAAACTGAAC
TACCTAGATGGATTCCTGGCCGACATGCAGGCGGCCTTCAAGGAAAAGTA
CGGCGACATACGTCTGGGCGATGACTACGACTTCGATCGCGAATATCGAC
GCGTGCTCAGCGCCGCGGAGGAGGCGTCCGCCAAGCAAGTGAAAGCACCT
AAAACCATGCGCTCCTACAACGAGTCACAGAAATCGAAAAAGACCGTCGC
CTCGATGATACAGGACGACAAGAAGCCGGTGGAGAAGCGGGTGAACATCC
AGGAGGCCCCGCCACCATCCAAATCACAGCCGTCGTCGCCACCGACGGGC
TCCCCAATGGACAAGATCATCATGGAGAAACGGCGCAAGCTGCGCGAAAA
GCTCACGCCCACCAAGAAGACCTCGCCCAGTGATTCCAAGTCCAGCAAGC
CCGAGAAGGCCGGCAAGAAGCCACGCGTCTGGGATCTGGGCGGTAATTCC
AAGGATGCCGCTCTGCTCGATCGCTCCAGGGATTCGCCCGATGATGTGCA
GTACCAGAACATCAACAGCGAGCTGGTGGGCACAATGCAGGGCGTCATCC
GCGACTTGGATGTGGAGAGCGAGGACGAGGCTGACAACGAGGATGCATCC
TCTGAGGGGGAGGCCGAGGAGCAGGTGCAGTCAAAGAAGGGCAAGCGCGG
TGGCCTGCTATCCTACTTCAAGGGCATTGTAGGCGCCAAGACCATGTCGC
TGGCAGATTTGCAGCCGGCGCTGGAGAAGATGCGCGACCATCTGATATCG
AAGAACGTGGCCTCTGAGATAGCAGCTAAGCTGTGCGACTCGGTGGCCGC
CAGTTTGGATGGCAAGCAAATGGGCACATTCGACAGCATCGCCAGCCAGG
TGAAGGAGGCGCTCACGGAATCGCTGGTGAGGATACTATCGCCCAAACGG
CGCATCGACATCATACGCGATGCCCTCGAATCGAAGCGCAACGGCCGCCC
GTACACGATAATCTTCTGCGGTGTCAATGGTGTCGGCAAGTCCACCAATT
TGGCCAAGATCTGCTTTTGGCTGATCGAGAACGATTTCAACGTTCTGATC
GCCGCCTGCGATACGTTCCGAGCCGGTGCCGTCGAGCAGTTGCGCACACA
CACACGCCATCTGAACGCACTGCATCCGGCGGCCAAGCACGATGGACGCA
ACATGGTGCAGTTGTACGAGAAGGGTTACGGCAAGGATGCCGCCGGCATT
GCCATGGAGGCCATCAAGTTTGCCCACGATACGCGAGTGGATGTGGTGCT
TGTGGACACCGCCGGACGCATGCAGGATAACGAGCCGCTGATGCGTTCCC
TGTCCAAGCTAATCAAAGTGAACAATCCGGATCTGGTGCTATTCGTGGGC
GAGGCACTGGTGGGCAACGAAGCCGTCGACCAGCTGGTCAAGTTCAATCA
GTCGCTGGCCGACTACTCATCCAACGAGAACCCGCACATCATCGACGGCA
TAGTGTTGACCAAGTTCGATACCATCGATGACAAGGTGGGCGCCGCCATC
TCCATGACCTACATAACCGGCCAGCCAATTGTGTTCGTGGGCACGGGTCA
GACGTATGCCGACCTAAAGGCCATCAATGTGAACGCCGTGGTCAATTCCC
TGATGAAGGCAAGCTTTCTAGACCAT

BO28650.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:35:12
Subject Length Description Subject Range Query Range Score Percent Strand
Gtp-bp-RA 1845 CG2522-PA 1..1842 17..1858 9210 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:35:13
Subject Length Description Subject Range Query Range Score Percent Strand
Gtp-bp-RA 2056 CG2522-RA 114..1955 17..1858 9210 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 21:35:10
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 11126978..11128065 1858..771 5440 100 Minus
X 23542271 X 11128151..11128795 772..128 3210 99.8 Minus
X 23542271 X 11128857..11128974 134..17 590 100 Minus
Blast to na_te.dros performed on 2014-11-26 21:35:11 has no hits.

BO28650.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-07-13 13:50:38 Download gff for BO28650.complete
Subject Subject Range Query Range Percent Splice Strand
Gtp-bp-RA 135..1971 22..1860 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 03:30:56 Download gff for BO28650.complete
Subject Subject Range Query Range Percent Splice Strand
Gtp-bp-RA 119..1955 22..1860 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:37:09 Download gff for BO28650.complete
Subject Subject Range Query Range Percent Splice Strand
Gtp-bp-RA 119..1955 22..1860 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 22:37:09 Download gff for BO28650.complete
Subject Subject Range Query Range Percent Splice Strand
X 11128858..11128969 22..133 100   Minus
X 11128151..11128789 134..772 100 <- Minus
X 11126976..11128063 773..1860 99 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 03:30:56 Download gff for BO28650.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 11022891..11023002 22..133 100   Minus
arm_X 11022184..11022822 134..772 100 <- Minus
arm_X 11021009..11022096 773..1860 99 <- Minus

BO28650.pep Sequence

Translation from 16 to 1876

> BO28650.pep
MLDFVVIFTKGGVVLWHSNASGNSFASCINSLIRGVILEERNTEAKYYEE
DHLAVQFKLDNELDLVYAAIFQKVIKLNYLDGFLADMQAAFKEKYGDIRL
GDDYDFDREYRRVLSAAEEASAKQVKAPKTMRSYNESQKSKKTVASMIQD
DKKPVEKRVNIQEAPPPSKSQPSSPPTGSPMDKIIMEKRRKLREKLTPTK
KTSPSDSKSSKPEKAGKKPRVWDLGGNSKDAALLDRSRDSPDDVQYQNIN
SELVGTMQGVIRDLDVESEDEADNEDASSEGEAEEQVQSKKGKRGGLLSY
FKGIVGAKTMSLADLQPALEKMRDHLISKNVASEIAAKLCDSVAASLDGK
QMGTFDSIASQVKEALTESLVRILSPKRRIDIIRDALESKRNGRPYTIIF
CGVNGVGKSTNLAKICFWLIENDFNVLIAACDTFRAGAVEQLRTHTRHLN
ALHPAAKHDGRNMVQLYEKGYGKDAAGIAMEAIKFAHDTRVDVVLVDTAG
RMQDNEPLMRSLSKLIKVNNPDLVLFVGEALVGNEAVDQLVKFNQSLADY
SSNENPHIIDGIVLTKFDTIDDKVGAAISMTYITGQPIVFVGTGQTYADL
KAINVNAVVNSLMKASFLDH

BO28650.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 06:57:22
Subject Length Description Subject Range Query Range Score Percent Strand
Gtp-bp-PA 614 CG2522-PA 1..614 1..614 3110 100 Plus
Srp54k-PA 508 CG4659-PA 28..295 315..613 221 22.7 Plus