Clone BO28674 Report

Search the DGRC for BO28674

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:286
Well:74
Vector:pDNR-Dual
Associated Gene/TranscriptCG3764-RA
Protein status:BO28674.pep: Imported from assembly
Sequenced Size:4189

Clone Sequence Records

BO28674.complete Sequence

4189 bp assembled on 2011-08-05

GenBank Submission: KX794475

> BO28674.complete
GAAGTTATCAGTCGACATGCATACGCCGCCCTTTAAATCCAATCGATTCC
CCTTCGAGGGCAGCCAGGTGCGAGTTCTGCTCTACAAAGAGGATGATACT
CGGCGATTGCTCTTCGACTCGAATGCCCTCCAGAAGGTGATGCACAAGGA
CCAATCGGCCACATCCGCATCCATATCATCGACCAGTACGAGTGGCGGGG
GAAAGTTCCTTAAGAATGAGAAGTACACATCGCTGCAGAATGGCAAGATT
CCGTCGAAGTCACATTCCAGCAATGGTAGCAATTTCATCGAGGTGTGCGC
AGAGTACGGCTATAAGCACAATCGACCCTCGGGAGCCGACATCACGCCGG
TGGGCGAAATGGTGTTTGGCTCGTTGCCGATGTCCTTTTGCGGAACGGCT
CTGAAGGTGCACTGGCTGCCGGAACCGTCCAGAATCCTGTGCTCCCAGGT
CTACCTGACGCCCACCAGTAATGGAGGATCTGGCCACTCGCCGTACTCTA
CGCTCTCCACGAATAGCCTGGCGACGCCGCGCACATCGATATGCAGCGAG
CATGGATCCATGGATGGTCTCTCGATGAACTCGTTCTCAATGCCGTTCAG
CGTGAGTGTAGGTCGGCAGATGAGCCTGACGCCACCGCTGGACGTTCCGG
CGACGCCGGCTGATCAGCAGTCACTGTCGATTCATTCGATCGACTCCAGC
GGTCCTCGATACTCATCAACATACAGCACTGCCACGGATTCGGGCTATTC
GGCCAGTGGGAGTGGCAGTGCAGCTGGAGGGGATCAGTGGTCATATCAGT
ACTCATCCACGCGCAGCAGTTTGGGCAGTGTCCTCTCGGATCAGTCGGAT
GCAATGCGGAAGCTGAGCATGGACTTGGCGTGCTATACGGGGTCTCCTTA
CCTGGACGGATTTGCCAGCGATGGCTGCCTGCAGCGAAGAATCTCGCGTA
ATTTGCGCACCTCCTTCGAGAACGAGCATTCCAAGAACGATTTTATCGGC
TTTCTTAGCGACAATTACGCATTGAATGGCCCTGTGGTAGCACCAGCAGG
AGGCGGAGCTGGAGGGGGCAGCGAAGGTGGTGGCATGGCTCCACCGCAGT
ATCGACGAGCGAGCTATTGTGCGAATGAAACGCGAAGTAATCCGGAAATG
GGCAGGAGGCAGGCCAATCTGCGGCGGCGGGCGAAACTGGGACTGGCCGT
GTGTATCTCGATGAGTGAGTCCTTCGAAGAGGAGATGGAGCTGTTTTGTA
GTGAGCATATTGCCTTGCTGGAATCTATGCTTAGTCGATTGAGAGCCAGT
ACAGAACTGGCTTACATCAACCACAAGAACTTTCTGCAGATCATGTTCCA
GGCCTGGCAGGATACGCAACAGTGGTTCAGCGATCTCTTCACTGCCCCGC
GCATCAAGACACCTGTCTGGCTGAGCATCACCACCAGTGGCAGCAAGTAC
TCCAAGACTGTGGCCGAGAGATTCATCAAGGAGCTGTGCGACCTACTCTC
CTTCGCCGATACTAAGGACTCTAATTTTTTTATTAGCACCATGCTGACGG
GAATTCTTACTCATCACCTCGGATGGGTAGCCACCGTGTCCGCCTTCAAT
AGCTCCGGTTCTAAACGATCGGAGTCGTCTGCCTCTGCAGCGGCCATTGA
GCAGAGGGCAAAGCTACTCCAAGTTGCCCAGAAGCATCCGTACAATGCGC
TGTGGGCCCAGCTCGGCGACCTTTATGGAGCCATCGGCATGCCGCCGAAG
CTGGCTCGCACCATTGTGTGTGGAGCAGAGAAGCTCTGGGTAGAGAAGCT
GCTAAACGTGCTCACATACTTTATTCGGTGCAGCGAAGTGCGGCGAGCGG
CCAAGCGGGAGGACTTTAACAAGCAGCTTATTAACGACCTTGCCGCCCAG
AGCCAGACGAAAAATCAAACGGGTACGCAGGAGAGGCACAAGAGTCCACC
GACGCAGAAGCGCGGATTGAGCAGGGCGGCAACCTGCAAACAGAATCTAA
ATGCAATTGCTGATGATGCGGACGATGAGAATGGCGAACTGAACATGTAC
GATAGGGACAACGAGGATGGGGACCCAGATGGTTTGGACTCTGGGTCCCT
GGACGCCAGCGATGGCATGCAGACTCTGAAAAAGAATGAGATTCCCACTG
TGTTGGCCTTCCGAGACTCTCACTTTGTGCAGCAGGAGCTGCGTATCGGA
AACTATTTAATGGACACAGGTATTGACAAGAAGATGCTGCTGGCGCGGCA
GGCACAGCAGTACTTTCGTACTGGCAAAGACGGCCGGATCCGTTTGACAG
TAACCACGCCGGATAACGTGGAGCTGTGCATGGAGGAGGAGCAGTCGAGC
GGCACTGGCTCCGTAAGTACAGGTTCCGTGGATGACGGTGCCATCGAGGC
CATCGACTATGAAGACAACGTGGAGGCACCTCCGAAAAAGAATTTCTTTT
GGAACATGGTGCCGGTAGCAGGTGTAAAGGAGGGACTGAGTCTAAGTGAT
TTGGCCAAGCTGCAGCAGGGCATTCGGATCATCAACCGCAAACTGGAGCG
ACGCAGCAGCAGCTACTCCGTTGAGGGAAACCCCGATCAACAGCAGAGCA
AGACTGGAGAAACTGGAGTAGGTGACTTTGAGCCCCTGAGTCATGAGAGA
CGAGCCTCGCATTTGTCACTCTCTGATTTGATAACGCAGAACAGCATGGG
CAAAAGCGATCGCATGACATGGGGCATTGAGCCCATAAAAGAAAACGTTA
GCCTGGAGGAGCAGATTCATTTTGATCACTGCCACAAGCTAATCGAGCGT
GAGCACGGCATCTGTCGACAAACATCCGCAGATAATGGCAACGGAGTAGT
CTTCGTCCTGGGCGACAATGAGCCACTGATCAACCTGAAAAAGAGCAGTG
AGGACCTGAGCGGAGATCAAGATTCTAAGCCAACTCTAATGCTGTGTGCA
CAACATCAGCGCACCCACGACAGAAGCAAGCACTCGGGTATGAAGTTCAA
TTTTGAACAGTATCCGCAAATAGCTACCAACTATATGAAGAACAAGAATC
TATTGATGTCTAACTACGATCTGCTAATGGACAAGGTCACCAAACTGGAG
GCCAGTGAGGCAGCTGCCCTAAAGGGTAGCGATAGCACGGCTACACTAGC
TGCTAGCAGTAGCTCCACGGCTGCACTGCTTCCACCGACAACTCCAGTGA
CTGCGAATAGCGATCGTTGCGTAGTTTGCAGCAGTGGCGTTGGCATAAAT
ACCTCGGCCACCTGGAACCAAACACCTTCCAATGCCACCGAACTGGAATT
CGAGACCGATGAAATGCATTGCTACAATCAAAGCGGGAACGGTAATGGAT
TCAGCTCAAAGGCTCTACAATCTGTAAACTCTGCGGCCTCCATAGACACG
CTAAAGTCCTCTGTTGCAGTCGAACCACCAACTCCAACGATCCCAACCCA
AATGCAGACCACGTACATGCGCAAGCAGCAGCCCAAACGAGTGCCGTCAG
GACGCAGTTCCGTCTCCTCGGTGGCCGCCAAGTGTGCAGCGGTCAACGTG
TCTCAGCAGCTCTTGAAACTGCCTGTTCCGGGCATCAAGGAATTGCCGCA
GGACGACGAATCTCCAGGCGACCAGCTGCGTGCCGGCTTCATTCCCTCGC
TGCTGTTAAGCGTTAGCGATCATTACGTCTCAGACATGGTATTGCAGGGT
ACTTGTGCTCCGCCCAATAAGTGGGAGATGCATCTGCGGGAGGATCTAGC
TCTGGCTGCGCGCTCAGCCTCGCTAATCTCGCAGCCGGCGGAGAACATTG
CAATTGTGGCGGACATGGACAAGTGGGATGTACGGCTAATTTCATCTCAG
ACGCAGCAGTTTCCTTATGCCGGTGGTCAGAGTTCTCCCGTGGGCATGTC
TCAGCTAGTGTCCAGCATGCTGGAAACCGTACAGGCCATGAATGCAGGCG
GCATACCAGCCTATGAGTGTTTGTCGTTCTTGGAGTCCAAGTTACAGGAA
ATCTACCTACAATCGGAAACTTTGGCAGCATTCCTGCTTGAGACTGATCC
GTGCCGACTGAGCGACATTACAAATCCACTGCAGTTGTCCGAAAATGATG
TACCATTGCTGCTGTCAATAGCATATATTCACACGCCCAAGATCAGCCGC
AAGTGCGGCATCAGCTTCAGGGCAAGCTTTCTAGACCAT

BO28674.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 01:34:59
Subject Length Description Subject Range Query Range Score Percent Strand
CG3764-RC 4158 CG3764-PC 1..4155 17..4171 20775 100 Plus
CG3764-RA 4158 CG3764-PA 1..4155 17..4171 20775 100 Plus
CG3764-RB 4410 CG3764-PB 279..4407 43..4171 20645 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 01:35:00
Subject Length Description Subject Range Query Range Score Percent Strand
CG3764-RC 5092 CG3764-RC 242..4397 16..4171 20780 100 Plus
CG3764-RA 5195 CG3764-RA 345..4500 16..4171 20780 100 Plus
CG3764-RB 6001 CG3764-RB 1178..5306 43..4171 20645 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 01:34:56
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 16996014..16998184 3698..1528 10855 100 Minus
3L 28110227 3L 16998525..16999549 1339..315 5125 100 Minus
3L 28110227 3L 16999739..17000012 316..43 1370 100 Minus
3L 28110227 3L 16995677..16995948 3967..3696 1360 100 Minus
3L 28110227 3L 16995412..16995617 4171..3966 1030 100 Minus
3L 28110227 3L 16998270..16998460 1527..1337 955 100 Minus
Blast to na_te.dros performed on 2014-11-27 01:34:57 has no hits.

BO28674.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-08-05 10:22:29 Download gff for BO28674.complete
Subject Subject Range Query Range Percent Splice Strand
CG3764-RA 260..4414 17..4173 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 04:57:25 Download gff for BO28674.complete
Subject Subject Range Query Range Percent Splice Strand
CG3764-RA 346..4500 17..4173 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 02:28:17 Download gff for BO28674.complete
Subject Subject Range Query Range Percent Splice Strand
CG3764-RA 346..4500 17..4173 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 02:28:17 Download gff for BO28674.complete
Subject Subject Range Query Range Percent Splice Strand
3L 17001516..17001541 17..42 100   Minus
3L 16999739..17000012 43..316 100 <- Minus
3L 16998525..16999547 317..1339 100 <- Minus
3L 16998270..16998457 1340..1527 100 <- Minus
3L 16996015..16998184 1528..3697 100 <- Minus
3L 16995677..16995946 3698..3967 100 <- Minus
3L 16995408..16995615 3968..4173 99 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 04:57:25 Download gff for BO28674.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 16994616..16994641 17..42 100   Minus
arm_3L 16992839..16993112 43..316 100 <- Minus
arm_3L 16991625..16992647 317..1339 100 <- Minus
arm_3L 16991370..16991557 1340..1527 100 <- Minus
arm_3L 16989115..16991284 1528..3697 100 <- Minus
arm_3L 16988777..16989046 3698..3967 100 <- Minus
arm_3L 16988508..16988715 3968..4173 99 <- Minus

BO28674.pep Sequence

Translation from 16 to 4189

> BO28674.pep
MHTPPFKSNRFPFEGSQVRVLLYKEDDTRRLLFDSNALQKVMHKDQSATS
ASISSTSTSGGGKFLKNEKYTSLQNGKIPSKSHSSNGSNFIEVCAEYGYK
HNRPSGADITPVGEMVFGSLPMSFCGTALKVHWLPEPSRILCSQVYLTPT
SNGGSGHSPYSTLSTNSLATPRTSICSEHGSMDGLSMNSFSMPFSVSVGR
QMSLTPPLDVPATPADQQSLSIHSIDSSGPRYSSTYSTATDSGYSASGSG
SAAGGDQWSYQYSSTRSSLGSVLSDQSDAMRKLSMDLACYTGSPYLDGFA
SDGCLQRRISRNLRTSFENEHSKNDFIGFLSDNYALNGPVVAPAGGGAGG
GSEGGGMAPPQYRRASYCANETRSNPEMGRRQANLRRRAKLGLAVCISMS
ESFEEEMELFCSEHIALLESMLSRLRASTELAYINHKNFLQIMFQAWQDT
QQWFSDLFTAPRIKTPVWLSITTSGSKYSKTVAERFIKELCDLLSFADTK
DSNFFISTMLTGILTHHLGWVATVSAFNSSGSKRSESSASAAAIEQRAKL
LQVAQKHPYNALWAQLGDLYGAIGMPPKLARTIVCGAEKLWVEKLLNVLT
YFIRCSEVRRAAKREDFNKQLINDLAAQSQTKNQTGTQERHKSPPTQKRG
LSRAATCKQNLNAIADDADDENGELNMYDRDNEDGDPDGLDSGSLDASDG
MQTLKKNEIPTVLAFRDSHFVQQELRIGNYLMDTGIDKKMLLARQAQQYF
RTGKDGRIRLTVTTPDNVELCMEEEQSSGTGSVSTGSVDDGAIEAIDYED
NVEAPPKKNFFWNMVPVAGVKEGLSLSDLAKLQQGIRIINRKLERRSSSY
SVEGNPDQQQSKTGETGVGDFEPLSHERRASHLSLSDLITQNSMGKSDRM
TWGIEPIKENVSLEEQIHFDHCHKLIEREHGICRQTSADNGNGVVFVLGD
NEPLINLKKSSEDLSGDQDSKPTLMLCAQHQRTHDRSKHSGMKFNFEQYP
QIATNYMKNKNLLMSNYDLLMDKVTKLEASEAAALKGSDSTATLAASSSS
TAALLPPTTPVTANSDRCVVCSSGVGINTSATWNQTPSNATELEFETDEM
HCYNQSGNGNGFSSKALQSVNSAASIDTLKSSVAVEPPTPTIPTQMQTTY
MRKQQPKRVPSGRSSVSSVAAKCAAVNVSQQLLKLPVPGIKELPQDDESP
GDQLRAGFIPSLLLSVSDHYVSDMVLQGTCAPPNKWEMHLREDLALAARS
ASLISQPAENIAIVADMDKWDVRLISSQTQQFPYAGGQSSPVGMSQLVSS
MLETVQAMNAGGIPAYECLSFLESKLQEIYLQSETLAAFLLETDPCRLSD
ITNPLQLSENDVPLLLSIAYIHTPKISRKCGISFRASFLDH

BO28674.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 07:16:00
Subject Length Description Subject Range Query Range Score Percent Strand
CG3764-PC 1385 CG3764-PC 1..1385 1..1385 7152 100 Plus
CG3764-PA 1385 CG3764-PA 1..1385 1..1385 7152 100 Plus
CG3764-PB 1469 CG3764-PB 93..1469 9..1385 7100 99.9 Plus