Clone BO28676 Report

Search the DGRC for BO28676

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:286
Well:76
Vector:pDNR-Dual
Associated Gene/TranscriptCG30015-RA
Protein status:BO28676.pep: Imported from assembly
Sequenced Size:4420

Clone Sequence Records

BO28676.complete Sequence

4420 bp assembled on 2011-08-05

GenBank Submission: KX797490

> BO28676.complete
GAAGTTATCAGTCGACATGTCTTCCGGCCTGATGTCGTGTGTAAGGGAAA
ACTCGCCGCCGCTGGAATCGGAGTTGGATGCCAGCTGCGCCGGGGGACCA
TTGTCATTGCCGGCGGGCCGCGCCCACCCGCACACCCACGGCGCCACCTC
AACGCCCATCTCCAGTCCAGGAAACGATGCCCATCAGTCCCCGACCGCCG
AGCATCCAAATCAGCAGCAGCAACAGCAGCAGCAGAAGCGTCGTCGTTTC
CATCCGCTTCGTAACCTGCGTCGCATCTTCCGGCGACGTACGATTAATAG
CTCCACGGACAGTCCAGCATCCTGTCAGTCGCCAGGACCCGGATCCTGCA
ACACCTTGCCACCGCCCGCCAGCAGCAGCAGTGAGAAGAATCTGCGCAGC
GGGATCGCCTCGCCAACAGGATCTCCCCTGAATCCCCAGCAGCTGAAGGA
GAACTACCAGACGCAATCGCTGCCCAAGTCCAAATCGTACGGTTCGCATC
GCGATGAGCTGCTAAGTGTGCTTCTGGGCAAAAAACGGGCCAGCAAGCAG
GACCACAGCCAGGTTGCAGTCCAACCCGATTCCCAAGCGCAGTCGCAATC
GCCGCAGGAAGCCATGTACCAGGCCCAGCGACAGCATGGCGGCGTGGCCG
TCTTCCCGGATTCACTAGTCCTTAACCGGAGCAGCTACTTTGCCGAGCAG
AGAATCCAACAGCGCCATCTACGCAGCGTGGGTGACTCCTCGCAGGAACT
GGAGTCCAACCTAGGCTTGGGATCAGGATCAGGATCAGGATCCGGAGCTG
GTGGCGCCGCTGACATCTCCGACAGCCAGCGTAGCCTCAGCGAAGGTCGA
CTCCTGGATGTGGACGGGGATTACTCTCGGGATACCCTGTCCCAGTCACA
TGACAGCGTCTTCTCTGAATCGGCCACAGCCAGCAGTCTATCCATTGTAC
TCAAGGCGGAACTCACGGATGTCCTGCGCAAGCGACGCAACAGACCCGAT
GCCTCTGACGAGGATTTGGGTCTGCCCCGCAGCCCGGCTTCTCCGCAACG
GCGAGCAGGGGGTGGAACCAGCAGTCGAAATACCTCCGGAGTGGGTCACC
AATCGCGGGGTCACCAGAGCGAGGTGTCTTCACTCAGCTTGCACAGTGTC
AATAGTGCCGAAGTGGAGACGGAGGACAGCCAGAGCTCCCATCAATACCG
TCATCACTCGCGAGTTTCCACCAGTTCATCCATCTCGATGGGCTCGGATA
TACTGCGATCACATCACGAGGACGACGTGGACGCCGTGGGCGGAGAACGT
CATCGTCTTTCCCATGCGGCGGCCAAGCACAAAATGGCCATTAGGCCTGT
GAAAAAGAAAGGACCCACCAGGCAGCACCGGATGACATTGGAGACTTCCA
TTCCGGAGGCCAATGAGGATGTGCTAAAGATTAGCCCTGGATTGAGGGCT
GTCCATGAAGCCGATCTCAAGATCAAGACGCGCTCTTTGCCACCGAAAAC
TTTAACTGCCATTGCACCGCCGGTTCAGGCTAACGCCGCCAGCTCGGTGA
CAACCAAGCGAACCAATACAATCGAGCAGAGCTCCACCATCACCAGCACC
ACTAAGACCACAAGCTCGTCCTCCACGACATCTCAGATGTTCGGACTTCG
AGGTCTGACCAGCAAGAGCAACGCTTTGCTGGAGAATCGCGGAGAGTCTT
CCACGGATGGGGACGACTTCCTGGCCAACGAGCGGGAGAAGGAGAACGAG
AGTGGATTCCTGCGCCGCCTGATCCACCGGAACTCCAAGAGATCCATAGC
CAGGGCCAACGACGGAGTTGAGGATACAGATTCCAGCCAGAGCGTGGCCA
AGAAGCTGCAGATCTCAACCTCCTGCTTGGAGGCCGCTGCTCGGGATGCC
GTTCAAGTGCCGGACAAGTCACGCAGTGCCACATCGCACGAGCAGCACAT
CCAGGAGACGCGACAAACAATCAAGCGGGAGATTCACAACGAGGGCAAGC
ACGGATTGAACGCCATGGTCAGTAACTACGGTGTGCATCCACATCCACCC
ACGGCATTAAAGCCGAAATCAGGTCCTGCCGCCAGGCAGCGATACATGCC
CAAGGAACTGGGAGCTGCTCCGCTGGAGAAGATCACCTCGGGTAACGATG
TGACCAACTTGCTGTCGAAGAGCTCGCGGGGCAACGACACCTTCCAGTCC
ACCACTTTGGTGCGGGAACAGCAGAACAAAGTGGAGACCTCAACGCATTT
CGAGAGGAAACCAAGGATTGTGGGCTTGAGTGCCTTCCAGCAGAAGCTAT
CGCGATCCAGTGACTCAGTGGGCCAGCACTCCAGCTCCTCCAACTCGTTG
GAGACCAGCACGGATGAGCCCTCGCCCCTGTACTACGAGGAGAAGCAGCG
CAAGACAATTGAAAAGTCCCGCAGCTTTCGAAATTATGAGGACGAGGCTG
TGGACTCCACGGCCGTGCACAACAATATGCCGAGTTTGCCGGATCTGTCG
CTAAGTTTTCGTGTGCCTGCCTACCACAAGCAGGCGCCACAATCGCCCTG
TTCCCCGATTTCCTCCAACGCCAAGTGTGTGTCACTGGGATTCGAGATCA
ACGACAACAAATTGCTGCAGTCCCGAGCTGAATCCACGGGCCAGTTGCCA
TCTGCTGCGAAAATCTCACCGCAAAAGGCCGCTTCCACAAAGCTAATAGT
TAGTAGTCCGGGTTCGGCTGATATCTCCAAGATCGAGCAGAACATTGACC
TTATCGTGAAATCACCTCTGGTGAGCGTTCTAAGGAAATCCGGTAATGTG
GCGGATAAGCTGCCCAAGGAGCAAACTGCTCCGACCAAACAGCGACCTAA
GCTACTCGATTTGGGAGCAAAGATGACAGCTCCTGCGGCAAATCCAAGTC
CCAGCCCGGCAAGTCCTTTGACCAAGAGTGCCAAGCTCTCGAACAGTCCA
CCCACCACACCGGCCAAAGGTCAGGGATCCTCCAACAGCAGTCGCCGGAA
TTCCAGTAACGTGGAGAATAACGGTGAGCCGGAGTTCATGAAGATCCAGC
TGAATCGCGTGGACCAGGCGCGTCTGCACAACAAGACCAATCACTTGGTG
CTAGCCAAGAACTTTAAGTCGCCCACGGAGCGGAGTCAGAGCAACGATGA
TCTCAGCTTCCGACGGAGCAGCGAAGAAAATCTGGCGGGAATCGAGATTG
TGGAGCACCCTCAGCCGAAGCCTCTAAGTCCGGCAATCAGGCCAACGGCA
CTGGAGCCCAGCTTGAGCAGGCAATTGAAATCCGTTAGTGCCACTAGTAT
GAGGAATAGCTATGGTAGTAGTAGTGAAGGATTAGCCACTCCAGTTACTC
CAGTCACTACACCAAGCACACCTAAAAGCAATGGGTTTTCGAAAAGTATT
CTCAGTGCTCCCAAGAACGTAAAGGAAGTTAAAGATACCAAGGAGCCAGT
CAGCCCGAAGGAGCCAGTGAAGAGCAATCGCCTCTCTCTGGAGGATCGCA
AGCGGTTATTCCTCAGCGAAGAGCGAACGAAGTCAGTGGAGCAGCGCAGG
AAGTCCATTACCAAGACAGAAAGCACTGCTCCACCCACTCCTTCGGTGAT
TCCAGCCACGCCCGCCATTCCAGTCACTCCGGTTACTCCCACCTCTCCCG
AAATATTCGAGGTCAATGGCAACACTTCACCCACCTCCAATCCCGTGGTG
TTGCGCAAGAAATCCTTTGCGAGCTGCAATGGCAATCCCAGTCCCTCCAA
GGACGATCCCACACCCGAGCTGATGAAGGTCTTTGCCCGCCGTTCACTAA
AAGTGAAGGATGATGACGTTGTGACATTGCCACAGGTACAACCAGCCGCT
CCAGTGAGCAGCAACAGTAAGAAGCTGTCGCCCAGTGGAGGCGGAGGTCA
GAGCGTGGATAGCGACAAGGAGAATCAGTCGAACAGCGAGGAGAAGCTGG
ACAAGCTGGCGCCCAAGAGCGAGCCCCAGGCGACCCATCACCCCAGCACC
AATCGCAATTCGGTTGCAGACTTCCGCAATCTCAACAATAATAACAATAA
CCATCAGCAGCAACAGAAGGTGCCACCCAAGGTGGTCACCTACCTGCCCC
CCATTAAGACCAGCAATCAGGGCCGCAATAGCCTGAATAACAATATAAGC
AATGGTAATGGGAGTGCAAGGCCCGCTGCTGAAAGGTTTTCCCTGCAACT
GAAGCAGGCCAACCCGACAGCAACTACTCCAACGTCTCCGGCAGCAGCAA
CACCTGTTGCAGCACCAACTGCAACATCTGCAGCAGCAACAGCATCAGTA
GCGCCCAGTAAACCCATCGAGAGATCAGCCACCGTGGGCGAGTTCAAGGG
AATCCACCAGAGACGCGCCGAGTGGGAGCAGAGGGCCAAGGAGGCGCTAA
AGGCAAGCTTTCTAGACCAT

BO28676.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 01:41:40
Subject Length Description Subject Range Query Range Score Percent Strand
CG30015-RF 4428 CG30015-PF 38..4425 15..4402 21940 100 Plus
CG30015-RB 4389 CG30015-PB 1..4386 17..4402 21930 100 Plus
CG30015-RA 4389 CG30015-PA 1..4386 17..4402 21930 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 01:41:42
Subject Length Description Subject Range Query Range Score Percent Strand
CG30015-RF 5363 CG30015-RF 172..4559 15..4402 21940 100 Plus
CG30015-RB 6242 CG30015-RB 1052..5438 16..4402 21935 100 Plus
CG30015-RA 5525 CG30015-RA 335..4721 16..4402 21935 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 01:41:35
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 10839906..10842851 4402..1457 14730 100 Minus
2R 25286936 2R 10848593..10849261 868..200 3345 100 Minus
2R 25286936 2R 10843074..10843513 1393..954 2200 100 Minus
2R 25286936 2R 10856124..10856308 200..16 925 100 Minus
2R 25286936 2R 10848452..10848541 956..867 450 100 Minus
2R 25286936 2R 10842918..10842983 1457..1392 330 100 Minus
Blast to na_te.dros performed 2014-11-27 01:41:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6737..6821 4218..4302 218 72.9 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2322..2658 3964..4302 203 55.2 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2735..2829 4210..4302 199 70.5 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6752..6889 4196..4334 199 64.6 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6621..6800 4119..4302 198 60.2 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2331..2418 4215..4302 197 69.3 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2293..2395 4193..4297 196 66.7 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6722..6811 4242..4334 196 72.3 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6645..6833 4105..4302 194 60 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6803..6951 4193..4346 191 62.2 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2436..2525 4218..4307 189 67.8 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6767..6864 4193..4294 185 67.6 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6788..6908 4193..4318 185 64.3 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2349..2428 4218..4297 184 70 Plus
roo 9092 roo DM_ROO 9092bp 1048..1148 4202..4302 181 64.4 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6744..6923 4109..4296 175 57.7 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2361..2492 4193..4316 174 62.1 Plus
roo 9092 roo DM_ROO 9092bp 1027..1130 4197..4302 174 64.2 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 1500..1599 4222..4316 172 68 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2307..2379 4230..4302 158 68.5 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 1500..1587 4202..4290 154 65.2 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 1516..1591 4258..4333 154 70.1 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2778..2860 4210..4294 150 67.4 Plus
Doc3-element 4740 Doc3-element DOC3 4740bp 508..573 4222..4290 149 71 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6720..6790 4264..4334 147 70.8 Plus
roo 9092 roo DM_ROO 9092bp 1059..1148 4246..4332 145 65.6 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2796..2927 4193..4323 144 58.6 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2307..2539 4036..4276 140 55.7 Plus
Doc3-element 4740 Doc3-element DOC3 4740bp 513..565 4242..4297 138 75 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2747..2800 4247..4297 137 75.9 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2312..2390 4259..4334 135 67.1 Plus
Dvir\Het-A 6610 Dvir\Het-A HETAVIR 6610bp 3225..3386 4173..4327 128 58.2 Plus
TART-B 10654 TART-B DM14101 10654bp Derived from U14101 (g603662) (Rel. 42, Last updated, Version 1). 115..196 4203..4286 127 64.7 Plus
TART-B 10654 TART-B DM14101 10654bp Derived from U14101 (g603662) (Rel. 42, Last updated, Version 1). 9145..9226 4203..4286 127 64.7 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 1536..1587 4215..4269 124 72.7 Plus
roo 9092 roo DM_ROO 9092bp 1052..1163 4184..4290 124 60.7 Plus

BO28676.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-08-05 13:39:06 Download gff for BO28676.complete
Subject Subject Range Query Range Percent Splice Strand
CG30015-RB 987..5372 17..4404 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 04:59:46 Download gff for BO28676.complete
Subject Subject Range Query Range Percent Splice Strand
CG30015-RF 174..4559 17..4404 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 02:30:10 Download gff for BO28676.complete
Subject Subject Range Query Range Percent Splice Strand
CG30015-RF 174..4559 17..4404 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 02:30:10 Download gff for BO28676.complete
Subject Subject Range Query Range Percent Splice Strand
2R 10856124..10856307 17..200 100   Minus
2R 10848594..10849260 201..867 100 <- Minus
2R 10848453..10848540 868..955 100 <- Minus
2R 10843074..10843511 956..1393 100 <- Minus
2R 10842918..10842981 1394..1457 100 <- Minus
2R 10839904..10842850 1458..4404 99 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 04:59:46 Download gff for BO28676.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 6743629..6743812 17..200 100   Minus
arm_2R 6736099..6736765 201..867 100 <- Minus
arm_2R 6735958..6736045 868..955 100 <- Minus
arm_2R 6730579..6731016 956..1393 100 <- Minus
arm_2R 6730423..6730486 1394..1457 100 <- Minus
arm_2R 6727409..6730355 1458..4404 99 <- Minus

BO28676.pep Sequence

Translation from 16 to 4420

> BO28676.pep
MSSGLMSCVRENSPPLESELDASCAGGPLSLPAGRAHPHTHGATSTPISS
PGNDAHQSPTAEHPNQQQQQQQQKRRRFHPLRNLRRIFRRRTINSSTDSP
ASCQSPGPGSCNTLPPPASSSSEKNLRSGIASPTGSPLNPQQLKENYQTQ
SLPKSKSYGSHRDELLSVLLGKKRASKQDHSQVAVQPDSQAQSQSPQEAM
YQAQRQHGGVAVFPDSLVLNRSSYFAEQRIQQRHLRSVGDSSQELESNLG
LGSGSGSGSGAGGAADISDSQRSLSEGRLLDVDGDYSRDTLSQSHDSVFS
ESATASSLSIVLKAELTDVLRKRRNRPDASDEDLGLPRSPASPQRRAGGG
TSSRNTSGVGHQSRGHQSEVSSLSLHSVNSAEVETEDSQSSHQYRHHSRV
STSSSISMGSDILRSHHEDDVDAVGGERHRLSHAAAKHKMAIRPVKKKGP
TRQHRMTLETSIPEANEDVLKISPGLRAVHEADLKIKTRSLPPKTLTAIA
PPVQANAASSVTTKRTNTIEQSSTITSTTKTTSSSSTTSQMFGLRGLTSK
SNALLENRGESSTDGDDFLANEREKENESGFLRRLIHRNSKRSIARANDG
VEDTDSSQSVAKKLQISTSCLEAAARDAVQVPDKSRSATSHEQHIQETRQ
TIKREIHNEGKHGLNAMVSNYGVHPHPPTALKPKSGPAARQRYMPKELGA
APLEKITSGNDVTNLLSKSSRGNDTFQSTTLVREQQNKVETSTHFERKPR
IVGLSAFQQKLSRSSDSVGQHSSSSNSLETSTDEPSPLYYEEKQRKTIEK
SRSFRNYEDEAVDSTAVHNNMPSLPDLSLSFRVPAYHKQAPQSPCSPISS
NAKCVSLGFEINDNKLLQSRAESTGQLPSAAKISPQKAASTKLIVSSPGS
ADISKIEQNIDLIVKSPLVSVLRKSGNVADKLPKEQTAPTKQRPKLLDLG
AKMTAPAANPSPSPASPLTKSAKLSNSPPTTPAKGQGSSNSSRRNSSNVE
NNGEPEFMKIQLNRVDQARLHNKTNHLVLAKNFKSPTERSQSNDDLSFRR
SSEENLAGIEIVEHPQPKPLSPAIRPTALEPSLSRQLKSVSATSMRNSYG
SSSEGLATPVTPVTTPSTPKSNGFSKSILSAPKNVKEVKDTKEPVSPKEP
VKSNRLSLEDRKRLFLSEERTKSVEQRRKSITKTESTAPPTPSVIPATPA
IPVTPVTPTSPEIFEVNGNTSPTSNPVVLRKKSFASCNGNPSPSKDDPTP
ELMKVFARRSLKVKDDDVVTLPQVQPAAPVSSNSKKLSPSGGGGQSVDSD
KENQSNSEEKLDKLAPKSEPQATHHPSTNRNSVADFRNLNNNNNNHQQQQ
KVPPKVVTYLPPIKTSNQGRNSLNNNISNGNGSARPAAERFSLQLKQANP
TATTPTSPAAATPVAAPTATSAAATASVAPSKPIERSATVGEFKGIHQRR
AEWEQRAKEALKASFLDH

BO28676.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 07:16:21
Subject Length Description Subject Range Query Range Score Percent Strand
CG30015-PF 1475 CG30015-PF 14..1475 1..1462 7407 100 Plus
CG30015-PB 1462 CG30015-PB 1..1462 1..1462 7407 100 Plus
CG30015-PA 1462 CG30015-PA 1..1462 1..1462 7407 100 Plus
CG30015-PE 1510 CG30015-PE 1..1510 1..1462 7348 96.8 Plus
CG30015-PC 1510 CG30015-PC 1..1510 1..1462 7348 96.8 Plus