Clone BO28686 Report

Search the DGRC for BO28686

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:286
Well:86
Vector:pDNR-Dual
Associated Gene/TranscriptCG4984-RA
Protein status:BO28686.pep: Imported from assembly
Sequenced Size:1414

Clone Sequence Records

BO28686.complete Sequence

1414 bp assembled on 2011-07-13

> BO28686.complete
GAAGTTATCAGTCGACATGAAGCGCGACGTGTCCACGTCGACCATCGGCC
GGGATGAGGCCCGTCGTCCGCTGATGGAGGCCTACATGTTCCAGCGGCGC
GTGCTGCTCGGCTGCAGTCTGCTCATGGTGGTTTCGCTGCTAATCTGGAT
AGTGGCCATCTCGACCGATCACTGGATCATCATATCCGGCGGAAAGGGCA
TTTTTATACCCGAATCTCGACGCTTCTTTATGTCCTCGCACTCGGGCTTG
TGGCGCCACTGCCGGAACACGATAGTGCCCAATGCCATGAGCAATGCCCA
GGTGGTGCGCAACTTTAGCTCCATGTCGTACACATCGCAGACGAACATCA
ACGAGGCGAAGCGGAATCTCTCGCAAATGGACTTCATCAAGGAGTTCGCG
CACGAGAAGCTGGAAACGTCGGACAACTTTACGGAATCGGCGCGTCGCCA
CATGTTTGCCCATTGGGTACGGGGCGAGGATATGGAGTTCCAGACGCTGC
GCCATGCCTTTCGCACCCTGGTGATGAACACCGAGGAGAATCAGCGGCAG
TTTAATGCCACGGCCATTAAGCCCATACCCATCAATCCGCTGGACGTGCA
GGGAATCATTGAGAGAAATACTTTCGGTTCGGCGCTGCAGCGGGTTAAGT
ACAACAACACTTGGTCTTACTACGTGATCCCGGAGGTGGCGCAGTTAGCC
ATCTTCAGGAACTGGACGGATTACCCACTGGTGGTACGACTGCTGGGCAC
CTACATCCGGGATATCAGCATCCCGGCCTACGTGCTTAACGATGAACGGG
TGATACTTATCCTAGTGCCACCGCTGCCGCCCAAGAAGGGTCAGCCCGCC
TACTACAGCTATATACCGAACCAGCGCTGCAAATACATCGACATGTTCCC
CAACTCCAATGCTCTGCGAAATGAGCCCGGTTTCGATGACGAACTATTGG
ACTATATCCGGACGCAGGCGTCCTTTGCCTGCATAACACTGTTCGTGATG
AGCTTGGGTGCCGTCTTCTCCTTCTACACGTTCATGAATCCGCGCTACAT
GTTCAAGCGTCTGGCGGGTGGCATCCACTTGGTGGCTGCCTCCACGGCGC
TGGTGGTTCTCCAGGTGCTCTTCTCCTCGATTGACTACACCAAAGAGCAT
CTGTTCTATGCGTATCCTGAAGGGGCGCAACTAACTTATGGCTACGGCGT
TTATTTGGCCTGGTTCACGTTCGTGGACAATATCCTGTGCGGTGTTATGT
TCCTCTGGTATTCTGGCAAGAAGAAGGGTGCCAAGGCGCCCAACGACGAG
GTGGCCATGGCCGACGAGCCGACCATCATGGGCAGAGCAAGCTTTCTAGA
CCATTCGTTTGGCGCGCGAACCGCAGGTAAGTGGTCGATAATCTATAATT
CAATAAAATCCCAA

BO28686.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 16:56:25
Subject Length Description Subject Range Query Range Score Percent Strand
CG4984-RB 1323 CG4984-PB 1..1320 17..1336 6390 98.9 Plus
CG4984-RA 1323 CG4984-PA 1..1320 17..1336 6390 98.9 Plus
CG4984-RD 1344 CG4984-PD 1..1341 17..1336 6145 97.4 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:56:27
Subject Length Description Subject Range Query Range Score Percent Strand
CG4984-RB 3112 CG4984-RB 1594..2913 17..1336 6390 98.9 Plus
CG4984-RA 1969 CG4984-RA 451..1770 17..1336 6390 98.9 Plus
CG4975-RE 3112 CG4975-RE 1594..2913 17..1336 6390 98.9 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 16:56:23
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 17731466..17732141 197..872 3230 98.5 Plus
2R 25286936 2R 17732344..17732584 950..1190 1190 99.6 Plus
2R 25286936 2R 17731204..17731385 17..198 880 98.9 Plus
2R 25286936 2R 17732638..17732788 1186..1336 755 100 Plus
2R 25286936 2R 17732198..17732275 873..950 360 97.4 Plus
Blast to na_te.dros performed on 2014-11-26 16:56:25 has no hits.

BO28686.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-07-13 10:17:22 Download gff for BO28686.complete
Subject Subject Range Query Range Percent Splice Strand
CG4984-RA 449..1773 17..1343 98   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 02:13:38 Download gff for BO28686.complete
Subject Subject Range Query Range Percent Splice Strand
CG4975-RE 1594..2918 17..1343 98   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 17:31:07 Download gff for BO28686.complete
Subject Subject Range Query Range Percent Splice Strand
CG4975-RE 1594..2918 17..1343 98   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 17:31:07 Download gff for BO28686.complete
Subject Subject Range Query Range Percent Splice Strand
2R 17732638..17732793 1186..1343 98   Plus
2R 17732345..17732579 951..1185 100 -> Plus
2R 17732198..17732275 873..950 97 -> Plus
2R 17731467..17732141 198..872 98 -> Plus
2R 17731204..17731384 17..197 98 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 02:13:38 Download gff for BO28686.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 13620143..13620298 1186..1343 98   Plus
arm_2R 13619850..13620084 951..1185 100 -> Plus
arm_2R 13619703..13619780 873..950 97 -> Plus
arm_2R 13618972..13619646 198..872 98 -> Plus
arm_2R 13618709..13618889 17..197 98 -> Plus

BO28686.pep Sequence

Translation from 16 to 1414

> BO28686.pep
MKRDVSTSTIGRDEARRPLMEAYMFQRRVLLGCSLLMVVSLLIWIVAIST
DHWIIISGGKGIFIPESRRFFMSSHSGLWRHCRNTIVPNAMSNAQVVRNF
SSMSYTSQTNINEAKRNLSQMDFIKEFAHEKLETSDNFTESARRHMFAHW
VRGEDMEFQTLRHAFRTLVMNTEENQRQFNATAIKPIPINPLDVQGIIER
NTFGSALQRVKYNNTWSYYVIPEVAQLAIFRNWTDYPLVVRLLGTYIRDI
SIPAYVLNDERVILILVPPLPPKKGQPAYYSYIPNQRCKYIDMFPNSNAL
RNEPGFDDELLDYIRTQASFACITLFVMSLGAVFSFYTFMNPRYMFKRLA
GGIHLVAASTALVVLQVLFSSIDYTKEHLFYAYPEGAQLTYGYGVYLAWF
TFVDNILCGVMFLWYSGKKKGAKAPNDEVAMADEPTIMGRASFLDHSFGA
RTAGKWSIIYNSIKSQ

BO28686.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 06:56:43
Subject Length Description Subject Range Query Range Score Percent Strand
CG4984-PB 440 CG4984-PB 1..440 1..440 2312 100 Plus
CG4984-PA 440 CG4984-PA 1..440 1..440 2312 100 Plus
CG4984-PD 447 CG4984-PD 1..447 1..440 2294 98.4 Plus
CG4984-PC 447 CG4984-PC 1..447 1..440 2294 98.4 Plus