Clone BO28694 Report

Search the DGRC for BO28694

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:286
Well:94
Vector:pDNR-Dual
Associated Gene/TranscriptCG31041-RA
Protein status:BO28694.pep: Imported from assembly
Sequenced Size:649

Clone Sequence Records

BO28694.complete Sequence

649 bp assembled on 2011-07-13

> BO28694.complete
GAAGTTATCAGTCGACATGTCGTTCAAGGCCGTCCCCCTTTTGTTGGCTA
TCGGCGCCGTCTTCGTGGCTGCCGTGCCCACTCCCGTCGAGACCGAGAGG
GAGTCCTCGCTGGTGGAGCTCCTGCTCAGTTCTCCGGCCATGCGATCGGA
TCTCTTCAACGTCGAATGCGTGGACTACTACAGCCCGCTCCTTAAGGGTC
ACGTGGACAAGTACAACGAGGACTTCACCGCGTGCAAGGACAATTACGAC
GGGGCCTTCTCCCTGATCGACTCAAGCTACCGCAGTTCCCGCGACGAGCT
GTCCGTATCCGTGAGGGACACCTGCCTTTCCCTCCTGACCTGCAATGGCA
GGACCTCGAACTCCGATGCCTTCGAGTGCTTGGCCTCTGGGGGTCCTTCG
GCATCCAAGGAACTGGAGAAAGCTTCCTACAACGCATCCGACAACCAAAC
CAGCCTGCTCGCCGAGGTGTCCGTAATCTCGGAAACGCTATCCAGATGCC
AAATCGAAGCCTACCGGACCTACAACACCAACCACGGCGAGTGCTACGCC
GACATGGTAGCCTGCCTGGGTGATCCCAACTGGGAGTTTCCCAGCACGAA
CTACGTGCTCGCAAGCTTTCTAGACCATTCGTTTGGCGCGCGAAAGGGG

BO28694.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 16:55:36
Subject Length Description Subject Range Query Range Score Percent Strand
CG31041-RA 597 CG31041-PA 1..594 17..610 2970 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:55:37
Subject Length Description Subject Range Query Range Score Percent Strand
CG31041-RA 700 CG31041-RA 25..618 17..610 2970 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 16:55:35
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 29590507..29590882 392..17 1880 100 Minus
3R 32079331 3R 29590152..29590371 610..391 1100 100 Minus
Blast to na_te.dros performed on 2014-11-26 16:55:36 has no hits.

BO28694.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-07-13 10:17:21 Download gff for BO28694.complete
Subject Subject Range Query Range Percent Splice Strand
CG31041-RA 25..618 17..610 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 02:13:19 Download gff for BO28694.complete
Subject Subject Range Query Range Percent Splice Strand
CG31041-RA 25..618 17..610 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 17:30:46 Download gff for BO28694.complete
Subject Subject Range Query Range Percent Splice Strand
CG31041-RA 25..618 17..610 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 17:30:46 Download gff for BO28694.complete
Subject Subject Range Query Range Percent Splice Strand
3R 29590508..29590882 17..391 100   Minus
3R 29590152..29590370 392..610 100 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 02:13:19 Download gff for BO28694.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 25416230..25416604 17..391 100   Minus
arm_3R 25415874..25416092 392..610 100 <- Minus

BO28694.pep Sequence

Translation from 16 to 649

> BO28694.pep
MSFKAVPLLLAIGAVFVAAVPTPVETERESSLVELLLSSPAMRSDLFNVE
CVDYYSPLLKGHVDKYNEDFTACKDNYDGAFSLIDSSYRSSRDELSVSVR
DTCLSLLTCNGRTSNSDAFECLASGGPSASKELEKASYNASDNQTSLLAE
VSVISETLSRCQIEAYRTYNTNHGECYADMVACLGDPNWEFPSTNYVLAS
FLDHSFGARKG

BO28694.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 06:56:41
Subject Length Description Subject Range Query Range Score Percent Strand
CG31041-PA 198 CG31041-PA 1..198 1..198 1024 100 Plus
CG10912-PA 271 CG10912-PA 1..189 1..188 236 28.4 Plus
CG10911-PA 359 CG10911-PA 1..185 1..184 230 29.2 Plus
CG7567-PA 211 CG7567-PA 50..193 41..184 148 25 Plus