Clone BO28696 Report

Search the DGRC for BO28696

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:286
Well:96
Vector:pDNR-Dual
Associated Gene/TranscriptCG32847-RB
Protein status:BO28696.pep: Imported from assembly
Sequenced Size:526

Clone Sequence Records

BO28696.complete Sequence

526 bp assembled on 2011-07-13

GenBank Submission: KX794276

> BO28696.complete
GAAGTTATCAGTCGACATGTCGGCTGATACTTTCGTAATGGACACCAAGG
ATGAATCGTTCTACGAGTGTAACATATGTCTAGACACCGCCCAGAATGCC
GTGGTCAGCATGTGTGGCCATTTGTTTTGCTGGCCATGTCTGTACCAATG
GATATTGACGAAACCCGATCACACAGTGTGTCCCGTTTGCAAGTCGGGCG
TGGATAGGAGCAAAGTAATACCGGTGTACGCACGAAATGATAAAAGGCAG
GAGGATCCGCGGGATAAAACACCGCCGCGTCCAACTGGAATTTGGTCGGA
TTACGCAAATGATCTCGAGTTGGGACTATTTTCGTACTTGCTTTTTGGTT
TATTCTTTCCATATGGTGCCCTATCATCTTATCTGGATATGGACGAGCCA
CTCAATCCTGCTGCTGATCACGGCATAAGGGATGGGCAGAACGAAACACT
CCTTTCTAAGTTCTTTCTCTACGTGGCCATTATGCTCATTATTTATATGA
TTGTAATTGCAAGCTTTCTAGACCAT

BO28696.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 16:56:40
Subject Length Description Subject Range Query Range Score Percent Strand
CG32847-RB 495 CG32847-PB 1..492 17..508 2460 100 Plus
CG8974-RE 834 CG8974-PE 365..543 60..238 310 78.2 Plus
CG8974-RD 834 CG8974-PD 365..543 60..238 310 78.2 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:56:41
Subject Length Description Subject Range Query Range Score Percent Strand
CG32847-RB 730 CG32847-RB 51..542 17..508 2460 100 Plus
CG8974-RE 1317 CG8974-RE 468..646 60..238 310 78.2 Plus
CG8974-RD 1280 CG8974-RD 431..609 60..238 310 78.2 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 16:56:38
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 15121622..15122113 17..508 2460 100 Plus
X 23542271 X 15794520..15794698 238..60 310 78.2 Minus
X 23542271 X 15797690..15797868 238..60 310 78.2 Minus
Blast to na_te.dros performed on 2014-11-26 16:56:39 has no hits.

BO28696.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-07-13 12:35:28 Download gff for BO28696.complete
Subject Subject Range Query Range Percent Splice Strand
CG32847-RB 51..542 17..510 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 02:13:43 Download gff for BO28696.complete
Subject Subject Range Query Range Percent Splice Strand
CG32847-RB 51..542 17..510 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 17:31:14 Download gff for BO28696.complete
Subject Subject Range Query Range Percent Splice Strand
CG32847-RB 51..542 17..510 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 17:31:14 Download gff for BO28696.complete
Subject Subject Range Query Range Percent Splice Strand
3L 15121622..15122113 17..510 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 02:13:43 Download gff for BO28696.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 15114722..15115213 17..510 99   Plus

BO28696.pep Sequence

Translation from 16 to 526

> BO28696.pep
MSADTFVMDTKDESFYECNICLDTAQNAVVSMCGHLFCWPCLYQWILTKP
DHTVCPVCKSGVDRSKVIPVYARNDKRQEDPRDKTPPRPTGIWSDYANDL
ELGLFSYLLFGLFFPYGALSSYLDMDEPLNPAADHGIRDGQNETLLSKFF
LYVAIMLIIYMIVIASFLDH

BO28696.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 06:56:47
Subject Length Description Subject Range Query Range Score Percent Strand
CG32847-PB 164 CG32847-PB 1..164 1..164 897 100 Plus
CG8974-PE 277 CG8974-PE 117..274 10..161 438 51.3 Plus
CG8974-PD 277 CG8974-PD 117..274 10..161 438 51.3 Plus
CG8974-PB 277 CG8974-PB 117..274 10..161 438 51.3 Plus
CG8974-PA 277 CG8974-PA 117..274 10..161 438 51.3 Plus