Clone BO28702 Report

Search the DGRC for BO28702

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:287
Well:2
Vector:pDNR-Dual
Associated Gene/TranscriptCG6330-RB
Protein status:BO28702.pep: Imported from assembly
Sequenced Size:1075

Clone Sequence Records

BO28702.complete Sequence

1075 bp assembled on 2011-08-24

GenBank Submission: KX797291

> BO28702.complete
GAAGTTATCAGTCGACATGTCGCTGCTGCTCACCGGAAACAGTGCCTCCC
TTTCCGAGGAGGAGCTCGACGAGTACTCCGATGGAACCGTCAAATTGCGC
AACTCGAACATTGAGCTCATGGACCAGGATATCCTCTATCACCTGGCCTT
GGGCAGCGAGAGCCACGACCTGCAGGAGATGTTTGGCGACGTTAAGTTCG
TTTGCATGGGCGGCACACCAAAGCGCATGGAGAATTTTGCCCATTTCATA
ATGAACGAGATTGGCTACAAGTTGCCAGCGGGCACCCAGCTGCAGGACAT
CAGCGCCTATTCGTATCGCTACTCCATGTACAAAGTGGGACCGGTGCTGT
GCGTCAGCCATGGCATGGGTACGCCCTCGGTCAGCATCCTGATGCATGAG
ATGATCAAGCTGATGTACCACGCCAAGTGCAAGGATCCCGTCTTCATCAG
GATAGGAACGTGCGGAGGAATTGGCGTCGACGGCGGCACCGTCATCATCA
CCGAAGATGCCCTCGATGGGCAGCTGAGGAACTCCCATGAGTTTACCATT
CTCGGCAAGACCATCCATCGTCCTGCCAAGCTGGACAAAAAGCTGGCCCG
TGAGCTAAAGTCCCTGGCCAGTCCCGATGATCCGTACGATACCATTATTG
GCAAGACGCTGTGCACCAACGATTTCTACGAGGGCCAGGGTCGTTTGGAC
GGCGCATTCTGTGATTTCAGCGAGAACGAGAAGATGGCCTATCTGGAGAA
GCTGCGCGAGAACGGCGTGGTCAACATCGAGATGGAGAGCACCATCTTTG
CGGCCCTGACCCACCATGCCGGCATCAAGGCAGCGGTGGTGTGTGTCGCC
CTGCTGAACCGCCTCAATGGGGATCAGGTCAACGCGCCCAAGGAGGTCAT
GAACGAGTGGCAAGCGCGTCCGCAGATCCTCGTGTCGCGCTATATTCGCA
AGGTCCTTACGCACAATGGACAGCTGAAGGCGCTATTCGGACACCAGGGA
TCCATCAAGTCACCCCGGCGCTTCAAGCTCGTCCAGCAGGAGTCTCAGGC
CCACGAGGCAAGCTTTCTAGACCAT

BO28702.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 06:36:31
Subject Length Description Subject Range Query Range Score Percent Strand
CG6330-RB 1044 CG6330-PB 1..1041 17..1057 5205 100 Plus
CG6330-RA 1107 CG6330-PA 120..1104 73..1057 4925 100 Plus
CG3788-RB 1137 CG3788-PB 390..566 322..498 345 79.7 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 06:36:32
Subject Length Description Subject Range Query Range Score Percent Strand
CG6330-RB 2075 CG6330-RB 299..1339 17..1057 5205 100 Plus
CG6330-RA 1541 CG6330-RA 252..1236 73..1057 4925 100 Plus
CG3788-RB 1758 CG3788-RB 928..1104 322..498 345 79.7 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 06:36:29
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 26950638..26951009 916..545 1860 100 Minus
3R 32079331 3R 26951072..26951428 544..188 1755 99.4 Minus
3R 32079331 3R 26950428..26950569 1057..916 710 100 Minus
3R 32079331 3R 26951775..26951898 196..73 620 100 Minus
2R 25286936 2R 22932746..22932922 498..322 345 79.7 Minus
3R 32079331 3R 26956517..26956575 75..17 295 100 Minus
Blast to na_te.dros performed 2014-11-27 06:36:30
Subject Length Description Subject Range Query Range Score Percent Strand
Tabor 7345 Tabor TABOR 7345bp 200..283 200..118 111 60.7 Minus
Tabor 7345 Tabor TABOR 7345bp 7039..7122 200..118 111 60.7 Minus

BO28702.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-08-24 14:34:23 Download gff for BO28702.complete
Subject Subject Range Query Range Percent Splice Strand
CG6330-RB 295..1335 17..1059 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 04:48:10 Download gff for BO28702.complete
Subject Subject Range Query Range Percent Splice Strand
CG6330-RB 299..1339 17..1059 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 07:49:31 Download gff for BO28702.complete
Subject Subject Range Query Range Percent Splice Strand
CG6330-RB 299..1339 17..1059 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 07:49:31 Download gff for BO28702.complete
Subject Subject Range Query Range Percent Splice Strand
3R 26956520..26956575 17..72 100   Minus
3R 26951775..26951898 73..196 100 <- Minus
3R 26951072..26951419 197..544 100 <- Minus
3R 26950638..26951009 545..916 100 <- Minus
3R 26950426..26950568 917..1059 98 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 04:48:10 Download gff for BO28702.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 22782242..22782297 17..72 100   Minus
arm_3R 22777497..22777620 73..196 100 <- Minus
arm_3R 22776794..22777141 197..544 100 <- Minus
arm_3R 22776360..22776731 545..916 100 <- Minus
arm_3R 22776148..22776290 917..1059 98 <- Minus

BO28702.pep Sequence

Translation from 16 to 1075

> BO28702.pep
MSLLLTGNSASLSEEELDEYSDGTVKLRNSNIELMDQDILYHLALGSESH
DLQEMFGDVKFVCMGGTPKRMENFAHFIMNEIGYKLPAGTQLQDISAYSY
RYSMYKVGPVLCVSHGMGTPSVSILMHEMIKLMYHAKCKDPVFIRIGTCG
GIGVDGGTVIITEDALDGQLRNSHEFTILGKTIHRPAKLDKKLARELKSL
ASPDDPYDTIIGKTLCTNDFYEGQGRLDGAFCDFSENEKMAYLEKLRENG
VVNIEMESTIFAALTHHAGIKAAVVCVALLNRLNGDQVNAPKEVMNEWQA
RPQILVSRYIRKVLTHNGQLKALFGHQGSIKSPRRFKLVQQESQAHEASF
LDH

BO28702.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 07:21:00
Subject Length Description Subject Range Query Range Score Percent Strand
CG6330-PB 347 CG6330-PB 1..347 1..347 1806 100 Plus
CG6330-PA 368 CG6330-PA 23..368 10..347 1724 96 Plus
CG3788-PB 378 CG3788-PB 46..346 18..317 932 57.5 Plus
CG3788-PA 378 CG3788-PA 46..346 18..317 932 57.5 Plus
CG17224-PD 300 CG17224-PD 2..298 21..314 693 45.2 Plus