Clone BO28704 Report

Search the DGRC for BO28704

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:287
Well:4
Vector:pDNR-Dual
Associated Gene/TranscriptAdf1-RC
Protein status:BO28704.pep: Imported from assembly
Sequenced Size:820

Clone Sequence Records

BO28704.complete Sequence

820 bp assembled on 2011-09-14

GenBank Submission: KX796130

> BO28704.complete
GAAGTTATCAGTCGACATGCATACCCTCACGGCGGCCATTGAGATGGACA
AGCTGGATGCCAATCTTGAGCAGCAGTTTGATCTCAATCTCATCGAGGCT
GTCAAGCTGAACCCAGTGATATACGACAGGTCGCACTACAATTACAAGCA
CTTTGTGCGCAAGGCCCAGACCTGGAAACAAATCGCCGAAACGCTCGGTG
TGCCTGAACAAAAATGTACGAAGCGCTGGAAGAGTCTGCGCGACAAGTTC
GCCCGCGAGATGAAACTATGTCAGGAATCGCGCTGGCGTTACTTCAAGCA
GATGCAATTCCTGGTTGACTCCATCCGCCAGTATCGAGAGTCGCTGCTCG
GCAAGTGCGCCAATGGGAGTCAAAGCGCCAACCAGGTGGCCGATCCGTCG
CAGCAGCAGCAGGCGCAGCAACAGACCGTCGTGGATATATTTGCACAGCC
CTTCAACGGCAGCGCCACAACCTCGGCCCAGGCACTGACCCATCCGCATG
AAATTACTGTCACCAGCGATGCACAGCTGGCCACTGCCGTGGGCAAGGAC
CAAAAGCCATACTTCTACGAGCCGCCGCTCAAGCGAGAGCGCAGTGAGGA
GGAGCACAGCGACAACATGCTCAACACCATCAAGATTTTCCAAAACAACG
TCTCGCAGGCGGTCAGCGCCGAGGACCAGTCGTTCGGCATGGTAGTCACG
GACATGCTCAACACGCTGGGCGTGCGACAAAAGGCAGAGGCGAAGGTGCA
CATCATCAAGTATCTGACGGACATGCAGCTTCTGGCACAGCACAACAAGT
ACGCAAGCTTTCTAGACCAT

BO28704.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 07:17:38
Subject Length Description Subject Range Query Range Score Percent Strand
Adf1-RC 789 CG15845-PC 1..786 17..802 3930 100 Plus
Adf1-RE 825 CG15845-PE 1..759 44..802 3795 100 Plus
Adf1-RB 762 CG15845-PB 1..759 44..802 3795 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 07:17:39
Subject Length Description Subject Range Query Range Score Percent Strand
Adf1-RC 1675 CG15845-RC 179..964 17..802 3930 100 Plus
Adf1-RE 1668 CG15845-RE 173..957 18..802 3925 100 Plus
Adf1-RB 1795 CG15845-RB 300..1084 18..802 3925 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 07:17:36
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 6667072..6667374 500..802 1515 100 Plus
2R 25286936 2R 6666719..6667013 206..500 1475 100 Plus
2R 25286936 2R 6662569..6662757 18..206 945 100 Plus
Blast to na_te.dros performed on 2014-11-27 07:17:37 has no hits.

BO28704.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-09-14 11:59:21 Download gff for BO28704.complete
Subject Subject Range Query Range Percent Splice Strand
Adf1-RC 180..965 17..804 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 05:11:10 Download gff for BO28704.complete
Subject Subject Range Query Range Percent Splice Strand
Adf1-RC 179..964 17..804 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 08:07:41 Download gff for BO28704.complete
Subject Subject Range Query Range Percent Splice Strand
Adf1-RC 179..964 17..804 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 08:07:41 Download gff for BO28704.complete
Subject Subject Range Query Range Percent Splice Strand
2R 6667073..6667374 501..804 99   Plus
2R 6666720..6667013 207..500 100 -> Plus
2R 6662567..6662757 17..206 99 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 05:11:10 Download gff for BO28704.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 2554578..2554879 501..804 99   Plus
arm_2R 2554225..2554518 207..500 100 -> Plus
arm_2R 2550072..2550262 17..206 99 -> Plus

BO28704.pep Sequence

Translation from 16 to 820

> BO28704.pep
MHTLTAAIEMDKLDANLEQQFDLNLIEAVKLNPVIYDRSHYNYKHFVRKA
QTWKQIAETLGVPEQKCTKRWKSLRDKFAREMKLCQESRWRYFKQMQFLV
DSIRQYRESLLGKCANGSQSANQVADPSQQQQAQQQTVVDIFAQPFNGSA
TTSAQALTHPHEITVTSDAQLATAVGKDQKPYFYEPPLKRERSEEEHSDN
MLNTIKIFQNNVSQAVSAEDQSFGMVVTDMLNTLGVRQKAEAKVHIIKYL
TDMQLLAQHNKYASFLDH

BO28704.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 08:15:33
Subject Length Description Subject Range Query Range Score Percent Strand
Adf1-PC 262 CG15845-PC 1..262 1..262 1355 100 Plus
Adf1-PB 253 CG15845-PB 1..253 10..262 1311 100 Plus
Adf1-PA 253 CG15845-PA 1..253 10..262 1311 100 Plus
Adf1-PE 274 CG15845-PE 1..253 10..262 1311 100 Plus
CG10949-PB 459 CG10949-PB 129..391 9..245 173 25.7 Plus