Clone BO28707 Report

Search the DGRC for BO28707

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:287
Well:7
Vector:pDNR-Dual
Associated Gene/TranscriptTpr2-RB
Protein status:BO28707.pep: Imported from assembly
Sequenced Size:1426

Clone Sequence Records

BO28707.complete Sequence

1426 bp assembled on 2011-09-14

GenBank Submission: KX795085

> BO28707.complete
GAAGTTATCAGTCGACATGTTGTACATTGCCGAGGAGAAGAAGAAACTGG
GCAACGACCAATACAAGGCGCAGAACTATCAGAATGCACTCAAGCTCTAC
ACGGATGCCATATCGCTGTGTCCGGACTCGGCGGCATACTATGGCAATCG
GGCCGCCTGCTACATGATGCTGCTCAACTATAATAGCGCCCTGACCGACG
CCCGACACGCCATACGCATCGATCCGGGCTTCGAGAAGGCCTACGTCCGT
GTGGCCAAGTGCTGTCTGGCCCTGGGCGACATTATTGGCACCGAACAGGC
CGTCAAAATGGTCAACGAGCTGAATTCGCTTAGCACGGCTGTTGCTGCCG
AACAGACGGCGGCGCAAAAGTTGCGCCAATTGGAGGCCACCATTCAGGCG
AACTACGATACGAAATCCTATCGCAATGTGGTCTTCTATTTGGATAGTGC
CTTGAAATTGGCGCCCGCCTGTTTGAAATATCGTCTACTCAAGGCTGAGT
GCCTTGCATTTTTGGGGCGATGTGATGAGGCCTTGGACATTGCGGTCAGT
GTAATGAAACTGGATACCACATCGGCGGATGCGATATACGTGAGAGGTCT
GTGCCTGTACTACACGGACAACCTGGACAAGGGAATTCTTCATTTCGAGC
GCGCCCTGACCCTCGACCCGGACCACTACAAGTCCAAGCAGATGCGCAGC
AAATGCAAGCAGCTCAAGGAGATGAAGGAGAACGGCAATATGCTATTCAA
GTCGGGTCGGTATCGCGAGGCACACGTTATCTACACGGACGCCCTGAAGA
TCGATGAACACAACAAGGATATCAATTCGAAATTGCTTTACAATCGGGCT
TTGGTCAACACGCGTATTGGCAATTTGCGAGAGGCCGTGGCCGATTGCAA
TCGAGTGCTGGAGCTGAATAGTCAGTATCTGAAGGCTCTGTTGCTGCGAG
CGCGCTGCTACAATGATCTGGAGAAGTTCGAGGAGTCGGTGGCGGACTAT
GAGACGGCGCTGCAGCTGGAGAAGACGCCGGAGATTAAGCGAATGCTGCG
CGAGGCCAAGTTTGCGTTGAAGAAGTCGAAGCGAAAGGACTACTACAAGA
TCCTGGGCATTGGACGCAATGCGTCCGACGACGAGATCAAGAAGGCGTAT
CGCAAAAAGGCGCTGGTACATCATCCGGATCGACACGCAAACAGCAGTGC
CGAGGAGCGCAAGGAGGAGGAGCTCAAGTTCAAGGAGGTGGGCGAGGCGT
ACGCCATACTGTCGGATGCTCACAAGAAGTCGCGCTACGACAGCGGCCAG
GATATCGAGGAGCAGGAGCAAGCCGACTTCGATCCGAATCAAATGTTCCG
CACATTCTTCCAATTCAACGGCGGTGGCCGGAATAATTCATCGTTCAACT
TTGAGTTCGCAAGCTTTCTAGACCAT

BO28707.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 07:18:09
Subject Length Description Subject Range Query Range Score Percent Strand
Tpr2-RE 1395 CG4599-PE 1..1392 17..1408 6960 100 Plus
Tpr2-RB 1395 CG4599-PB 1..1392 17..1408 6960 100 Plus
Tpr2-RD 1527 CG4599-PD 141..1524 25..1408 6920 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 07:18:10
Subject Length Description Subject Range Query Range Score Percent Strand
Tpr2-RE 2373 CG4599-RE 646..2037 17..1408 6960 100 Plus
Tpr2-RB 2103 CG4599-RB 376..1767 17..1408 6960 100 Plus
Tpr2-RD 2503 CG4599-RD 513..1896 25..1408 6920 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 07:18:07
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 16506008..16506852 478..1322 4225 100 Plus
2L 23513712 2L 16505496..16505948 25..477 2265 100 Plus
2L 23513712 2L 16506927..16507014 1321..1408 440 100 Plus
Blast to na_te.dros performed on 2014-11-27 07:18:07 has no hits.

BO28707.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-09-14 11:59:22 Download gff for BO28707.complete
Subject Subject Range Query Range Percent Splice Strand
Tpr2-RB 384..1770 22..1410 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 05:11:23 Download gff for BO28707.complete
Subject Subject Range Query Range Percent Splice Strand
Tpr2-RB 381..1767 22..1410 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 08:07:50 Download gff for BO28707.complete
Subject Subject Range Query Range Percent Splice Strand
Tpr2-RB 381..1767 22..1410 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 08:07:50 Download gff for BO28707.complete
Subject Subject Range Query Range Percent Splice Strand
2L 16506929..16507014 1323..1410 97   Plus
2L 16506008..16506852 478..1322 100 -> Plus
2L 16505492..16505948 22..477 99 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 05:11:23 Download gff for BO28707.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 16506929..16507014 1323..1410 97   Plus
arm_2L 16506008..16506852 478..1322 100 -> Plus
arm_2L 16505492..16505948 22..477 99 -> Plus

BO28707.pep Sequence

Translation from 16 to 1426

> BO28707.pep
MLYIAEEKKKLGNDQYKAQNYQNALKLYTDAISLCPDSAAYYGNRAACYM
MLLNYNSALTDARHAIRIDPGFEKAYVRVAKCCLALGDIIGTEQAVKMVN
ELNSLSTAVAAEQTAAQKLRQLEATIQANYDTKSYRNVVFYLDSALKLAP
ACLKYRLLKAECLAFLGRCDEALDIAVSVMKLDTTSADAIYVRGLCLYYT
DNLDKGILHFERALTLDPDHYKSKQMRSKCKQLKEMKENGNMLFKSGRYR
EAHVIYTDALKIDEHNKDINSKLLYNRALVNTRIGNLREAVADCNRVLEL
NSQYLKALLLRARCYNDLEKFEESVADYETALQLEKTPEIKRMLREAKFA
LKKSKRKDYYKILGIGRNASDDEIKKAYRKKALVHHPDRHANSSAEERKE
EELKFKEVGEAYAILSDAHKKSRYDSGQDIEEQEQADFDPNQMFRTFFQF
NGGGRNNSSFNFEFASFLDH

BO28707.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 08:15:35
Subject Length Description Subject Range Query Range Score Percent Strand
Tpr2-PE 464 CG4599-PE 1..464 1..464 2389 100 Plus
Tpr2-PB 464 CG4599-PB 1..464 1..464 2389 100 Plus
Tpr2-PD 508 CG4599-PD 48..508 4..464 2373 100 Plus
Tpr2-PC 478 CG4599-PC 18..478 4..464 2373 100 Plus
Tpr2-PA 508 CG4599-PA 48..508 4..464 2373 100 Plus