Clone BO28708 Report

Search the DGRC for BO28708

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:287
Well:8
Vector:pDNR-Dual
Associated Gene/TranscriptCG6327-RD
Protein status:BO28708.pep: Imported from assembly
Sequenced Size:1504

Clone Sequence Records

BO28708.complete Sequence

1504 bp assembled on 2011-08-24

GenBank Submission: KX797030

> BO28708.complete
GAAGTTATCAGTCGACATGTCGACGCCAGAGAACAAAATCCCGACGGTCA
CTGCGGGCTACGGAGAAAACGAGAAGCCCAAAGGCGGCAAAGGCGGGCAA
TCCAAGTTCATACGTTCGGACATGGCCGACGTACCCGTGCAGCAGGCGGC
AGGATCGACGCTTCCGTTGGTAATCTCTCGGAAAAAAGGCGACGACTCCG
AGGATGGCAACTACAATCCGTTCGAGCACCGCAAGGTGGAGCATCCGACA
TCGGATCTCGAGACATTTGTACACTTGCTAAAGGGATCGCTTGGCTCCGG
AATATTGGCCATGCCAATGGCCTTCTCCCACGCTGGATTGTGGTTCGGTT
TGGTGGCCACCTTCGCGGTGGGCACCTTGTGCACCTACTGCGTCCACATT
CTGGTCAAGTGCGCCCACATCCTGTGCCGACGTCGTAAAATCCCGATGAT
GGGATTCGCCGATGTGGCGGAACAGGCTTTCCTCGACGGACCACCTGCCC
TGAATCGCTGGTCACGCTTCATCCGGTTCATGGTCAATACGTTTCTGGTT
ATCGATTTGCTGGGCTGCTGCTGCATCTATCTGGTTTTCGTGGCCACCAA
TGTGGAGCAGGTCGTGCGGGTGTATATGGAAACGGAGCTGAGCATTAGAG
TTTGGATCATGATCGTGACGGCACCGCTAATCTTTATGTGCCTGGTACGC
AACCTGAAATTCCTCACGCCCTTCTCGATGATAGCCAACATCCTGATGTT
CGTGGGCATCGTGATCACCTTCATCTATATGTTCTCCGATATTCCTGCAC
CCGTGGAACGTCCTGGAATTGTGAGTGTAACCGAATGGCCATTGTTCTTC
GGCACCGTGATCTTTGCTCTGGAGGGCATCGGTGTAGTTATGTCCCTGGA
GAACGACATGAAGAACCCCAGCCACTTCATCGGTTGCCCATCTGTCCTGA
ACTTCGGCATGGGTCTGGTGATTGCCCTCTACACTCTGGTTGGATTCTTT
GGCTTCCTGAAGTACGGCCCGGAAACCCAGGCCAGCATTACGCTGAATCT
GCCCCTGGAGGATAAGTTGGCCCAATCCGTCAAGTTGATGATTGCCATCG
CCATCTTCTTCACCTTCACCCTGCAGTTCTACGTGCCCGTCACGATTTTG
TGGAAGGGTCTGGAGCACAAGATCCGGCCGGAGAAGCAGAACATCAGTGA
ATACGGACTTCGTGTCTTTCTGGTGCTTCTGTGCGGCGGAATCGCAGTGG
CTCTGCCCAACTTGGGACCTTTCATCTCGCTAATTGGAGCGGTGTGCCTG
AGTACGCTGGGCATGATCGTTCCGGCGACCATTGAGCTGGCCGTGTATCA
TGAGGATCCCGGATACGGGCGCTTCAATTGGCGGCTGTGGAAGAACTCCG
GACTGATACTGTTCGGCGTGGTGGGTTTCGTGGCCGGAACCTATGTCAGC
ATCATCGAATTCCACGCCGAATTCAGCAGCGGTCACGCAAGCTTTCTAGA
CCAT

BO28708.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 06:37:25
Subject Length Description Subject Range Query Range Score Percent Strand
CG43693-RD 1473 CG43693-PD 1..1470 17..1486 7335 99.9 Plus
CG43693-RG 1719 CG43693-PG 265..1716 35..1486 7245 99.9 Plus
CG43693-RB 1509 CG43693-PB 55..1506 35..1486 7245 99.9 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 06:37:26
Subject Length Description Subject Range Query Range Score Percent Strand
CG43693-RD 2188 CG43693-RD 92..1562 16..1486 7340 99.9 Plus
CG43693-RG 2434 CG43693-RG 357..1808 35..1486 7245 99.9 Plus
CG43693-RB 2399 CG43693-RB 322..1773 35..1486 7245 99.9 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 06:37:23
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 11037620..11038434 1067..253 4060 99.9 Minus
3L 28110227 3L 11036984..11037245 1486..1225 1310 100 Minus
3L 28110227 3L 11037396..11037555 1225..1066 800 100 Minus
3L 28110227 3L 11039617..11039764 253..106 740 100 Minus
3L 28110227 3L 11039996..11040068 107..35 365 100 Minus
Blast to na_te.dros performed on 2014-11-27 06:37:24 has no hits.

BO28708.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-08-24 14:34:24 Download gff for BO28708.complete
Subject Subject Range Query Range Percent Splice Strand
CG6327-RD 91..1560 17..1488 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 04:48:41 Download gff for BO28708.complete
Subject Subject Range Query Range Percent Splice Strand
CG43693-RD 93..1562 17..1488 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 07:49:55 Download gff for BO28708.complete
Subject Subject Range Query Range Percent Splice Strand
CG43693-RD 93..1562 17..1488 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 07:49:55 Download gff for BO28708.complete
Subject Subject Range Query Range Percent Splice Strand
3L 11051262..11051279 17..34 100   Minus
3L 11039998..11040068 35..105 100 <- Minus
3L 11039618..11039764 106..252 100 <- Minus
3L 11037622..11038434 253..1065 99 <- Minus
3L 11037396..11037555 1066..1225 100 <- Minus
3L 11036981..11037244 1226..1488 99 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 04:48:41 Download gff for BO28708.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 11044362..11044379 17..34 100   Minus
arm_3L 11033098..11033168 35..105 100 <- Minus
arm_3L 11032718..11032864 106..252 100 <- Minus
arm_3L 11030722..11031534 253..1065 99 <- Minus
arm_3L 11030496..11030655 1066..1225 100 <- Minus
arm_3L 11030081..11030344 1226..1488 99 <- Minus

BO28708.pep Sequence

Translation from 16 to 1504

> BO28708.pep
MSTPENKIPTVTAGYGENEKPKGGKGGQSKFIRSDMADVPVQQAAGSTLP
LVISRKKGDDSEDGNYNPFEHRKVEHPTSDLETFVHLLKGSLGSGILAMP
MAFSHAGLWFGLVATFAVGTLCTYCVHILVKCAHILCRRRKIPMMGFADV
AEQAFLDGPPALNRWSRFIRFMVNTFLVIDLLGCCCIYLVFVATNVEQVV
RVYMETELSIRVWIMIVTAPLIFMCLVRNLKFLTPFSMIANILMFVGIVI
TFIYMFSDIPAPVERPGIVSVTEWPLFFGTVIFALEGIGVVMSLENDMKN
PSHFIGCPSVLNFGMGLVIALYTLVGFFGFLKYGPETQASITLNLPLEDK
LAQSVKLMIAIAIFFTFTLQFYVPVTILWKGLEHKIRPEKQNISEYGLRV
FLVLLCGGIAVALPNLGPFISLIGAVCLSTLGMIVPATIELAVYHEDPGY
GRFNWRLWKNSGLILFGVVGFVAGTYVSIIEFHAEFSSGHASFLDH

BO28708.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 07:21:02
Subject Length Description Subject Range Query Range Score Percent Strand
CG43693-PD 490 CG43693-PD 1..490 1..490 2562 100 Plus
CG43693-PG 572 CG43693-PG 84..572 2..490 2534 99.2 Plus
CG43693-PB 502 CG43693-PB 15..502 3..490 2532 99.4 Plus
CG43693-PA 502 CG43693-PA 15..502 3..490 2532 99.4 Plus
CG43693-PE 499 CG43693-PE 14..499 5..490 2532 99.6 Plus