Clone BO28709 Report

Search the DGRC for BO28709

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:287
Well:9
Vector:pDNR-Dual
Associated Gene/TranscriptCG5172-RD
Protein status:BO28709.pep: Imported from assembly
Sequenced Size:618

Clone Sequence Records

BO28709.complete Sequence

618 bp assembled on 2011-08-24

> BO28709.complete
GAAGTTATCAGTCGACATGCGTCACGCTGTGATCCTTGTTTTCGTGTGTT
GCCTGCTGATCGCCTTAACCTCAGCCGGTTTGCTGGGCGGTGGAGGCGGT
GGTGGTGGCTACGGCGGTGGTGGTGGTGGTGGCTACGGCGGTGGTGGTGG
TGGTCAGAGCGGCTACGGCGGCGGTGGCCAAAAGAACGGAGGAGGCGGCC
ATGGAGGTGGCGGCCAGGGAAGCTACGGAGGCGGTAGCCAAGGTGGACAT
GGAGGCGGTGGCCAAGGAGGTTGGCAGAAGAACGGAGGAGGTGGTGGACA
AGGAGGCTATGGAGGTGGCAATCAAGGTGGCCACGGAGGACAAGGAGGTT
ATGGCGGCGGCGGTCATGGAGGCGGTGGCCATGCAAGCAAGTCCTTGGCC
GGCAATCGCGGTAGTTCCGTGTCCTGGCAGGGCGGAAATGGAGGCAACAA
GAACGGAGGCGGCGGAGGAGGTGGTGGTGGCCTGTACGGTGGTGGTGGCG
GTGGAGGTGGCAAACAACATGGCGGTGGCTGGGCAAGCTTTCTAGACCAT
TCGTTTGGCGCGCGAACGCGAGGTAAGTGGTCTATAATCGATAAATCAAT
AATTCAATTATATTCCGA

BO28709.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 06:37:40
Subject Length Description Subject Range Query Range Score Percent Strand
CG5172-RD 519 CG5172-PD 1..516 17..532 2580 100 Plus
CG5172-RC 321 CG5172-PC 1..277 17..293 1385 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 06:37:41
Subject Length Description Subject Range Query Range Score Percent Strand
CG5172-RD 788 CG5172-RD 106..621 17..532 2580 100 Plus
CG5172-RC 531 CG5172-RC 106..382 17..293 1385 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 06:37:38
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 17221547..17221773 17..243 1135 100 Plus
X 23542271 X 17222277..17222484 325..532 1040 100 Plus
X 23542271 X 17222124..17222211 241..328 440 100 Plus
Blast to na_te.dros performed on 2014-11-27 06:37:39 has no hits.

BO28709.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-08-24 14:34:25 Download gff for BO28709.complete
Subject Subject Range Query Range Percent Splice Strand
CG5172-RD 106..624 17..536 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 04:48:50 Download gff for BO28709.complete
Subject Subject Range Query Range Percent Splice Strand
CG5172-RD 106..624 17..536 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 07:50:01 Download gff for BO28709.complete
Subject Subject Range Query Range Percent Splice Strand
CG5172-RD 106..624 17..536 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 07:50:01 Download gff for BO28709.complete
Subject Subject Range Query Range Percent Splice Strand
X 17222279..17222498 327..549 95 -> Plus
X 17222126..17222209 243..326 100 -> Plus
X 17221547..17221772 17..242 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 04:48:50 Download gff for BO28709.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 17116312..17116531 327..549 95 -> Plus
arm_X 17116159..17116242 243..326 100 -> Plus
arm_X 17115580..17115805 17..242 100 -> Plus

BO28709.pep Sequence

Translation from 16 to 616

> BO28709.pep
MRHAVILVFVCCLLIALTSAGLLGGGGGGGGYGGGGGGGYGGGGGGQSGY
GGGGQKNGGGGHGGGGQGSYGGGSQGGHGGGGQGGWQKNGGGGGQGGYGG
GNQGGHGGQGGYGGGGHGGGGHASKSLAGNRGSSVSWQGGNGGNKNGGGG
GGGGGLYGGGGGGGGKQHGGGWASFLDHSFGARTRGKWSIIDKSIIQLYS

BO28709.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 07:21:11
Subject Length Description Subject Range Query Range Score Percent Strand
CG5172-PD 172 CG5172-PD 1..172 1..172 998 100 Plus
CG5172-PC 106 CG5172-PC 1..92 1..92 526 100 Plus
CG14191-PA 193 CG14191-PA 3..189 8..173 399 47.2 Plus
Cpr47Ef-PD 601 CG13214-PD 248..406 25..172 386 51.6 Plus
Cpr47Ef-PC 612 CG13214-PC 248..406 25..172 386 51.6 Plus
Cpr47Ef-PD 601 CG13214-PD 306..473 21..171 382 54.2 Plus
Cpr47Ef-PD 601 CG13214-PD 272..451 19..172 380 48.9 Plus
Cpr47Ef-PD 601 CG13214-PD 248..420 24..171 378 51.4 Plus
Cpr47Ef-PD 601 CG13214-PD 340..505 21..171 373 50.9 Plus
Cpr47Ef-PD 601 CG13214-PD 233..390 22..171 372 51.8 Plus
Cpr47Ef-PD 601 CG13214-PD 374..527 21..171 358 50 Plus
Cpr47Ef-PD 601 CG13214-PD 405..591 21..169 303 43.9 Plus
CG14191-PA 193 CG14191-PA 20..138 60..174 265 50.4 Plus
Cpr47Ef-PD 601 CG13214-PD 235..364 37..173 263 46.2 Plus
CG14191-PA 193 CG14191-PA 79..190 13..103 221 46 Plus
Cpr47Ef-PD 601 CG13214-PD 235..344 52..183 219 43.9 Plus
Cpr47Ef-PD 601 CG13214-PD 31..279 16..173 213 31.7 Plus
Cpr47Ef-PD 601 CG13214-PD 29..119 20..125 211 48.2 Plus
CG14191-PA 193 CG14191-PA 20..118 79..189 194 39.3 Plus
Cpr47Ef-PD 601 CG13214-PD 235..314 99..186 167 45.5 Plus