Clone BO28712 Report

Search the DGRC for BO28712

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:287
Well:12
Vector:pDNR-Dual
Associated Gene/TranscriptCG15203-RA
Protein status:BO28712.pep: Imported from assembly
Sequenced Size:418

Clone Sequence Records

BO28712.complete Sequence

418 bp assembled on 2011-08-24

GenBank Submission: KX794872

> BO28712.complete
GAAGTTATCAGTCGACATGCATCCGGAACGCTACGCCAGTCCAAATCCAT
TGATACCATTGGTAATCGCAGGCGCCCTGCTCTTCTCGATGCTCTCGCAG
GTGAGCGGCTACTCGGGACGAATTCCACCGGATGCAGATAATCCCGGGAA
GTGCATGTACCGCGGTGACGTCCTGGAACTGGGTGTCAACAATGGCATCG
CTCCCTGCCAGCGACTGACTTGCAACAAGGATGGATCAATACTTATCGAG
GGTTGCGGCAAACTGCGCATCGAAAACTGCAACCGAGGCGAGCGAATCTC
TCCGGGTGAACCCTTTCCGGAATGCTGCAAGCTGAGATACAAGTGCAAGC
AAATCGGAGCGGCACCCTACTACATCGAGCGGAATACGGCGGAGAAGGTC
GCAAGCTTTCTAGACCAT

BO28712.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 06:35:44
Subject Length Description Subject Range Query Range Score Percent Strand
CG15203-RB 387 CG15203-PB 1..384 17..400 1920 100 Plus
CG15203-RA 387 CG15203-PA 1..384 17..400 1920 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 06:35:45
Subject Length Description Subject Range Query Range Score Percent Strand
CG15203-RB 900 CG15203-RB 61..444 17..400 1920 100 Plus
CG15203-RA 610 CG15203-RA 53..436 17..400 1920 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 06:35:42
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 11067775..11067923 252..400 745 100 Plus
X 23542271 X 11066612..11066732 17..137 605 100 Plus
X 23542271 X 11066813..11066930 135..252 590 100 Plus
Blast to na_te.dros performed on 2014-11-27 06:35:43 has no hits.

BO28712.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-08-24 14:34:21 Download gff for BO28712.complete
Subject Subject Range Query Range Percent Splice Strand
CG15203-RA 33..416 17..402 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 04:47:44 Download gff for BO28712.complete
Subject Subject Range Query Range Percent Splice Strand
CG15203-RA 53..436 17..402 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 07:49:11 Download gff for BO28712.complete
Subject Subject Range Query Range Percent Splice Strand
CG15203-RA 53..436 17..402 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 07:49:11 Download gff for BO28712.complete
Subject Subject Range Query Range Percent Splice Strand
X 11067776..11067923 253..402 98   Plus
X 11066816..11066930 138..252 100 -> Plus
X 11066612..11066732 17..137 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 04:47:44 Download gff for BO28712.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 10961809..10961956 253..402 98   Plus
arm_X 10960849..10960963 138..252 100 -> Plus
arm_X 10960645..10960765 17..137 100 -> Plus

BO28712.pep Sequence

Translation from 16 to 418

> BO28712.pep
MHPERYASPNPLIPLVIAGALLFSMLSQVSGYSGRIPPDADNPGKCMYRG
DVLELGVNNGIAPCQRLTCNKDGSILIEGCGKLRIENCNRGERISPGEPF
PECCKLRYKCKQIGAAPYYIERNTAEKVASFLDH

BO28712.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 07:20:58
Subject Length Description Subject Range Query Range Score Percent Strand
CG15203-PB 128 CG15203-PB 1..128 1..128 697 100 Plus
CG15203-PA 128 CG15203-PA 1..128 1..128 697 100 Plus