Clone BO28717 Report

Search the DGRC for BO28717

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:287
Well:17
Vector:pDNR-Dual
Associated Gene/TranscriptCG15239-RA
Protein status:BO28717.pep: Imported from assembly
Sequenced Size:1513

Clone Sequence Records

BO28717.complete Sequence

1513 bp assembled on 2011-08-24

GenBank Submission: KX798271

> BO28717.complete
GAAGTTATCAGTCGACATGACCAGCTCGAGGAATATGCTACTGATGCTGC
TCCTGGTGGCCAGTGCCTCCATACTTCAACTGGAGGCCAAGACCGTGTTC
CGGCGCACAGACAAGATATCGGAGAACTTCAAGCAGTTAGATTTGCCGCC
AGAGGAGATCGATCCCAATGTGGCGCCACCGGAATCGGAGCCGCCCAAGG
TGGAGGATGTCGCTGATGTGGCGGATGAGGTGGTCAATGCCGTGTCGCCT
GCTTCGTCCATCGACGAGAGTGCCAATGAGATAGCCAGCGGTGATGTGGA
TACCCCGAATGCTGCAGCTTCCGTTGCAGAAGCTGTCGCCCCAGCCGCTG
CCGTTCCCGAGGTCGCAGAGGCAGCTGCTCCGGCGGTGGCCACCACTCTA
GCGGCCAAGCCTACCACTGCACCGACCACCGCCAAGCCGGAGAATCCCAT
CAGCAAGTTCTGCAAGTGCTCGGAGAGCCACTGCGACTGCTGCCGGAAGT
TCGGATTGCCATTGCTGCCCAGCGGACCTGGCTGCGCCAAGATCGCCTAT
GTGGGCAACGACGAGATGAGCGTGTCCCTCAAATACGGTGGCATCACCTT
GGCCTCTCGTCGCATCTCCAGCAAGCGGGCTCGCCCCATTTGCGTGGGCC
TGCCCGGCGGCTACTCCAAGTTCTGCGGCAAGGTCTATGGTCTGTCCCGT
TCCAAGGAGTCCAAGGACTTCAAGGCATGCCTGGCCTTTGAACTGCGCTC
CGACGACGAGGTGGAGGCCTCCCTGCGCGTCTCCTGTTTCAAGTTTGGAC
CGGAAGGAGTCCGGGTGGCCGAGGCGGAGCCGTTGCCTGTGAAGCCCAGT
TCGGATGACGATGATGACGACGATGATGACCTCTTTGGATTTGCCGCTGG
TGGCGACGATGACGAGGATGAGGAGGACGACTATGACAGCGACAACGATA
CGGATGCGGATGCCGATGACGACGATGACACCGAGGACTATGCCGATGAT
GACGAGGCCGAGGCGCCCGAGGATGCTGATTACGGTGGCTTTAGTTTGGC
CGGACTTCTGGACGAGCTCGACGATGACGACGATGAGAAGCCGGTTAAGA
AGCCAGCGGCTGCGGCTGCGTCAGCGGCTGCTGACCAAACCCGCGAGCAT
GTAATTGCCGATGGCCAGGTGACCGCGACTACGACGAACGGCGACCAGGT
GCAGAGCAAGGACGATACGGGAGCTCCTGCCGCTGGCGAGGCTGTTGCAG
CTGCTGCACCTGCTGCGCCTGCTGCTCCTCTTGCTGCTCCTGCAGCCGCA
GCACCGATTGAGGGAGAAGTGGCCGCAGCGGTGACACCGGCTACCACAGC
TGCCGCCGATGAAGACTCCACCACGCCCAAGTCCAAGAAGTCCAAGAAGG
CGAAAAAGAACAAGAAGAAGAAGGCCGCCGCAGAGGCGACGGATGAGACT
GGATTCGCCTACGAGCTCCTCAATGGCATCCTGGATTTTTTCAACGCAAG
CTTTCTAGACCAT

BO28717.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 06:38:22
Subject Length Description Subject Range Query Range Score Percent Strand
CG15239-RA 1482 CG15239-PA 1..1479 17..1495 7395 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 06:38:23
Subject Length Description Subject Range Query Range Score Percent Strand
CG15239-RA 1997 CG15239-RA 322..1800 17..1495 7395 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 06:38:20
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 3888663..3889542 17..896 4400 100 Plus
X 23542271 X 3889690..3890289 896..1495 3000 100 Plus
Blast to na_te.dros performed on 2014-11-27 06:38:21 has no hits.

BO28717.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-08-24 14:34:27 Download gff for BO28717.complete
Subject Subject Range Query Range Percent Splice Strand
CG15239-RA 318..1796 17..1497 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 04:49:17 Download gff for BO28717.complete
Subject Subject Range Query Range Percent Splice Strand
CG15239-RA 318..1796 17..1497 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 07:50:24 Download gff for BO28717.complete
Subject Subject Range Query Range Percent Splice Strand
CG15239-RA 322..1800 17..1497 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 07:50:24 Download gff for BO28717.complete
Subject Subject Range Query Range Percent Splice Strand
X 3889691..3890289 897..1497 99   Plus
X 3888663..3889542 17..896 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 04:49:17 Download gff for BO28717.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 3783724..3784322 897..1497 99   Plus
arm_X 3782696..3783575 17..896 100 -> Plus

BO28717.pep Sequence

Translation from 16 to 1513

> BO28717.pep
MTSSRNMLLMLLLVASASILQLEAKTVFRRTDKISENFKQLDLPPEEIDP
NVAPPESEPPKVEDVADVADEVVNAVSPASSIDESANEIASGDVDTPNAA
ASVAEAVAPAAAVPEVAEAAAPAVATTLAAKPTTAPTTAKPENPISKFCK
CSESHCDCCRKFGLPLLPSGPGCAKIAYVGNDEMSVSLKYGGITLASRRI
SSKRARPICVGLPGGYSKFCGKVYGLSRSKESKDFKACLAFELRSDDEVE
ASLRVSCFKFGPEGVRVAEAEPLPVKPSSDDDDDDDDDLFGFAAGGDDDE
DEEDDYDSDNDTDADADDDDDTEDYADDDEAEAPEDADYGGFSLAGLLDE
LDDDDDEKPVKKPAAAAASAAADQTREHVIADGQVTATTTNGDQVQSKDD
TGAPAAGEAVAAAAPAAPAAPLAAPAAAAPIEGEVAAAVTPATTAAADED
STTPKSKKSKKAKKNKKKKAAAEATDETGFAYELLNGILDFFNASFLDH

BO28717.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 07:21:19
Subject Length Description Subject Range Query Range Score Percent Strand
CG15239-PA 493 CG15239-PA 1..493 1..493 2515 100 Plus
ect-PE 548 CG6611-PE 46..229 275..446 211 34.8 Plus
ect-PD 280 CG6611-PD 46..269 275..472 209 31.7 Plus
ect-PB 581 CG6611-PB 46..216 275..433 204 35.7 Plus
ect-PA 581 CG6611-PA 46..216 275..433 204 35.7 Plus