Clone BO28718 Report

Search the DGRC for BO28718

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:287
Well:18
Vector:pDNR-Dual
Associated Gene/TranscriptCG30349-RA
Protein status:BO28718.pep: Imported from assembly
Sequenced Size:1894

Clone Sequence Records

BO28718.complete Sequence

1894 bp assembled on 2011-09-19

GenBank Submission: KX795064

> BO28718.complete
GAAGTTATCAGTCGACATGTCGCTGGGCAAGAAGCACGTGTTGGGATTTT
CGCCCAATGGTGGCCAACTATTTGCCTCGGTGGACGAGTCGGGAGTTCTG
CGGATATGGAACACAGAGACGAACACGCTGTATCAGGAGTTTACGCCCAA
TCTACAGTTATCCGGGTCGTGCACAGCTCTCACGTGGGTTTTGGTGGCCG
GTTCCCGGCCCAAGAAGTCGCGGAAGAGCCTCCAGGCACAGGATGCAGCC
GGTGATCAGCTTCACATTGCTCTGGGAACGTACAAGGGCTCAGTGGTTAT
ATACTCATTAGCCGAGGGAAAGATTTCTCGAACGCTCAGTGGCGACAGCC
ATGATGGACCAGTGACCTCAATTACAAATGACAACGCTGGCCACCTATAC
ACTGTGGGTGCCGATTGTAGGGTTGTTGTTTGGTCCTTGACGGACGAGCG
CTCCATCGCCGAATGGCAAGTGGGACCCGAGAAGCCCCAAAATATAGTCT
ACCTTCAGAAAAGTGGCACCTTGGCCATTGGCTACCGACAGCTGAAGGTG
TACGATATCAAGACAAAGGAGCTGGTGGAAACGTTCACCGGCCACTCGGG
CGAAATAAACACAATCAGCAGCGTGGCGAGCACAGATGGCACTGAATTCG
TTTTGACCACCGCGAAGATGGAGCGCGTAATCTGCTTCTGGAAGATCGAC
AAGAAGGGCAAGAACAAAGCCTCCGCCTGCACGCTCCTCATGGAGGACTT
GGCCTACTGTCTAACCAGCGAAGTGCGCGACGATGGTCAGCTACGTGTGG
CCAGTGTTACCCGCAATGGCATCATACACATTTACCTGTTGAATGTGAAC
AGTTTATCCGCAGAGAAGTTTGTGAAGCCCAAGGTTTCGCTGCAGATCGT
TTCCGATGGCGCCGAAACAGTGGAACCACTTCTAGCCGTGGCGGCCCACT
TTGTGACAGACTCAAATCGCTCCCACGAAATCCTCTTTGGCTACGGAAGT
CGCCAACAGCTGCAGTTTGAACGTTTTACGCCCAACTATGGCGAGAAACT
AAACGTTATTGTGCGCGCCGATCCCAAAAAGCTCTATGCGAAAAAGAAGG
GAAAGGAGCAGCCGGGCTACCAGGCCGCCACCAAGGTCCAGAAGCCCATT
GTAAACCAAAAAAATGTGGAGTACAACAGCGCCCTGCCCATCTCGCAGAA
GAAAGTGCAAAACGAAGTGCCCATGGAAGCCCGACTAGAACATCTTAAAA
TTCAAGGAACCAAACTGAGTGGCGGCAAGTTGTTGACGCAGAGCAAAACG
CAGCTGCTAATGCAGGCATTACACAGCAAGGATCAGGCGATGATACAAGC
CGTTCTGAGCACTCAGGATCCAGAGACGATACAGTTGACCTTGGATCGGC
TACCGCTCGATTATGTCAATCCCCTGGTCAACGAACTTTCCATCCTGCTG
CAAGGAAAGCACGCGAGTGTCCGCTCCGCCCTGCGTTGGCTGCACGCACT
GACCTCCACCCACACTAGTGTCTTGATGTCCGAGGACAAGGAGGCTTTGC
GCGAAAAACTAGCCGTTTGCCTCGGCGTGGCGGAGCAGCGCATGCACTGT
CTATCGGAAGCTTTGCAAATAACCGGGCGAGTCAACCTGATAATTAACCA
GATGAAACGCAACGCGGACAATCATCTCAACGATAACAAAGCCCTGATCC
TGGACGAAGATCCAGATGAGCCCGATCCCGAAGCAGAAACGAACTGGAGC
GATCTGGAGGAGGATCAGCCAGGCAGTCCGAAGAGCCCATTGGAAGACGA
GCTGGTGGCCGACGACGACCTGGCGACCGACGATGGTAACGCCGACGCAG
ACACAGACTCTGACGTATCCATGGATGCAAGCTTTCTAGACCAT

BO28718.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 10:27:11
Subject Length Description Subject Range Query Range Score Percent Strand
CG30349-RA 1863 CG30349-PA 1..1860 17..1876 9300 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 10:27:12
Subject Length Description Subject Range Query Range Score Percent Strand
CG30349-RA 2014 CG30349-RA 74..1933 17..1876 9300 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 10:27:09
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 8907948..8908479 321..852 2660 100 Plus
2R 25286936 2R 8908531..8909021 849..1339 2455 100 Plus
2R 25286936 2R 8907591..8907896 17..322 1530 100 Plus
2R 25286936 2R 8910641..8910804 1713..1876 820 100 Plus
2R 25286936 2R 8909260..8909411 1466..1617 760 100 Plus
2R 25286936 2R 8909077..8909205 1339..1467 645 100 Plus
2R 25286936 2R 8910487..8910584 1618..1715 490 100 Plus
Blast to na_te.dros performed on 2014-11-27 10:27:10 has no hits.

BO28718.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-09-19 10:42:06 Download gff for BO28718.complete
Subject Subject Range Query Range Percent Splice Strand
CG30349-RA 72..1931 17..1878 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:38:52 Download gff for BO28718.complete
Subject Subject Range Query Range Percent Splice Strand
CG30349-RA 74..1933 17..1878 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:22:13 Download gff for BO28718.complete
Subject Subject Range Query Range Percent Splice Strand
CG30349-RA 74..1933 17..1878 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 11:22:13 Download gff for BO28718.complete
Subject Subject Range Query Range Percent Splice Strand
2R 8910644..8910804 1716..1878 98   Plus
2R 8910487..8910584 1618..1715 100 -> Plus
2R 8909262..8909411 1468..1617 100 -> Plus
2R 8909077..8909205 1339..1467 100 -> Plus
2R 8908535..8909020 853..1338 100 -> Plus
2R 8907950..8908479 323..852 100 -> Plus
2R 8907591..8907896 17..322 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:38:52 Download gff for BO28718.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 4798149..4798309 1716..1878 98   Plus
arm_2R 4797992..4798089 1618..1715 100 -> Plus
arm_2R 4796767..4796916 1468..1617 100 -> Plus
arm_2R 4796582..4796710 1339..1467 100 -> Plus
arm_2R 4796040..4796525 853..1338 100 -> Plus
arm_2R 4795455..4795984 323..852 100 -> Plus
arm_2R 4795096..4795401 17..322 100 -> Plus

BO28718.pep Sequence

Translation from 16 to 1894

> BO28718.pep
MSLGKKHVLGFSPNGGQLFASVDESGVLRIWNTETNTLYQEFTPNLQLSG
SCTALTWVLVAGSRPKKSRKSLQAQDAAGDQLHIALGTYKGSVVIYSLAE
GKISRTLSGDSHDGPVTSITNDNAGHLYTVGADCRVVVWSLTDERSIAEW
QVGPEKPQNIVYLQKSGTLAIGYRQLKVYDIKTKELVETFTGHSGEINTI
SSVASTDGTEFVLTTAKMERVICFWKIDKKGKNKASACTLLMEDLAYCLT
SEVRDDGQLRVASVTRNGIIHIYLLNVNSLSAEKFVKPKVSLQIVSDGAE
TVEPLLAVAAHFVTDSNRSHEILFGYGSRQQLQFERFTPNYGEKLNVIVR
ADPKKLYAKKKGKEQPGYQAATKVQKPIVNQKNVEYNSALPISQKKVQNE
VPMEARLEHLKIQGTKLSGGKLLTQSKTQLLMQALHSKDQAMIQAVLSTQ
DPETIQLTLDRLPLDYVNPLVNELSILLQGKHASVRSALRWLHALTSTHT
SVLMSEDKEALREKLAVCLGVAEQRMHCLSEALQITGRVNLIINQMKRNA
DNHLNDNKALILDEDPDEPDPEAETNWSDLEEDQPGSPKSPLEDELVADD
DLATDDGNADADTDSDVSMDASFLDH

BO28718.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 07:59:01
Subject Length Description Subject Range Query Range Score Percent Strand
CG30349-PA 620 CG30349-PA 1..620 1..620 3168 100 Plus