Clone BO28721 Report

Search the DGRC for BO28721

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:287
Well:21
Vector:pDNR-Dual
Associated Gene/TranscriptCG6327-RC
Protein status:BO28721.pep: Imported from assembly
Sequenced Size:1480

Clone Sequence Records

BO28721.complete Sequence

1480 bp assembled on 2011-08-24

GenBank Submission: KX796249

> BO28721.complete
GAAGTTATCAGTCGACATGTACAAGAACATCGACAATGAGTCCTCCACGA
CCATGTTTGAAATGTACTCCTCCTCGGATAGGTTCATACGTTCGGACATG
GCCGACGTACCCGTGCAGCAGGCGGCAGGATCGACGCTTCCGTTGGTAAT
CTCTCGGAAAAAAGGCGACGACTCCGAGGATGGCAACTACAATCCGTTCG
AGCACCGCAAGGTGGAGCATCCGACATCGGATCTCGAGACATTTGTACAC
TTGCTAAAGGGATCGCTTGGCTCCGGAATATTGGCCATGCCAATGGCCTT
CTCCCACGCTGGATTGTGGTTCGGTTTGGTGGCCACCTTCGCGGTGGGCA
CCTTGTGCACCTACTGCGTCCACATTCTGGTCAAGTGCGCCCACATCCTG
TGCCGACGTCGTAAAATCCCGATGATGGGATTCGCCGATGTGGCGGAACA
GGCTTTCCTCGACGGACCACCTGCCCTGAATCGCTGGTCACGCTTCATCC
GGTTCATGGTCAATACGTTTCTGGTTATCGATTTGCTGGGCTGCTGCTGC
ATCTATCTGGTTTTCGTGGCCACCAATGTGGAGCAGGTCGTGCGGGTGTA
TATGGAAACGGAGCTGAGCATTAGAGTTTGGATCATGATCGTGACGGCAC
CGCTAATCTTTATGTGCCTGGTACGCAACCTGAAGTTCCTCACGCCCTTC
TCGATGATAGCCAACATCCTGATGTTCGTGGGCATCGTGATCACCTTCAT
CTATATGTTCTCCGATATTCCTGCACCCGTGGAACGTCCTGGAATTGTGA
GTGTAACCGAATGGCCATTGTTCTTCGGCACCGTGATCTTTGCTCTGGAG
GGCATCGGTGTAGTTATGTCCCTGGAGAACGACATGAAGAACCCCAGCCA
CTTCATCGGTTGCCCATCTGTCCTGAACTTCGGCATGGGTCTGGTGATTG
CCCTCTACACTCTGGTTGGATTCTTTGGCTTCCTGAAGTACGGCCCGGAA
ACCCAGGCCAGCATTACGCTGAATCTGCCCCTGGAGGATAAGTTGGCCCA
ATCCGTCAAGTTGATGATTGCCATCGCCATCTTCTTCACCTTCACCCTGC
AGTTCTACGTGCCCGTCACGATTTTGTGGAAGGGTCTGGAGCACAAGATC
CGGCCGGAGAAGCAGAACATCAGTGAATACGGACTTCGTGTCTTTCTGGT
GCTTCTGTGCGGCGGAATCGCAGTGGCTCTGCCCAACTTGGGACCTTTCA
TCTCGCTAATTGGAGCGGTGTGCCTGAGTACGCTGGGCATGATCGTTCCG
GCGACCATTGAGCTGGCCGTGTATCATGAGGATCCCGGATACGGGCGCTT
CAATTGGCGGCTGTGGAAGAACTCCGGACTGATACTGTTCGGCGTGGTGG
GTTTCGTGGCCGGAACCTATGTCAGCATCATCGAATTCCACGCCGAATTC
AGCAGCGGTCACGCAAGCTTTCTAGACCAT

BO28721.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 06:38:55
Subject Length Description Subject Range Query Range Score Percent Strand
CG43693-RC 1449 CG43693-PC 1..1446 17..1462 7230 100 Plus
CG43693-RG 1719 CG43693-PG 336..1716 82..1462 6905 100 Plus
CG43693-RB 1509 CG43693-PB 126..1506 82..1462 6905 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 06:38:56
Subject Length Description Subject Range Query Range Score Percent Strand
CG43693-RC 2163 CG43693-RC 92..1537 17..1462 7230 100 Plus
CG43693-RG 2434 CG43693-RG 428..1808 82..1462 6905 100 Plus
CG43693-RB 2399 CG43693-RB 393..1773 82..1462 6905 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 06:38:53
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 11037620..11038434 1043..229 4075 100 Minus
3L 28110227 3L 11036984..11037245 1462..1201 1310 100 Minus
3L 28110227 3L 11039617..11039829 229..17 1065 100 Minus
3L 28110227 3L 11037396..11037555 1201..1042 800 100 Minus
Blast to na_te.dros performed on 2014-11-27 06:38:54 has no hits.

BO28721.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-08-24 14:34:28 Download gff for BO28721.complete
Subject Subject Range Query Range Percent Splice Strand
CG6327-RC 92..1537 17..1464 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 04:49:38 Download gff for BO28721.complete
Subject Subject Range Query Range Percent Splice Strand
CG43693-RC 92..1537 17..1464 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 07:50:39 Download gff for BO28721.complete
Subject Subject Range Query Range Percent Splice Strand
CG43693-RC 92..1537 17..1464 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 07:50:39 Download gff for BO28721.complete
Subject Subject Range Query Range Percent Splice Strand
3L 11039618..11039829 17..228 100   Minus
3L 11037622..11038434 229..1041 100 <- Minus
3L 11037396..11037555 1042..1201 100 <- Minus
3L 11036981..11037244 1202..1464 99 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 04:49:38 Download gff for BO28721.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 11032718..11032929 17..228 100   Minus
arm_3L 11030722..11031534 229..1041 100 <- Minus
arm_3L 11030496..11030655 1042..1201 100 <- Minus
arm_3L 11030081..11030344 1202..1464 99 <- Minus

BO28721.pep Sequence

Translation from 16 to 1480

> BO28721.pep
MYKNIDNESSTTMFEMYSSSDRFIRSDMADVPVQQAAGSTLPLVISRKKG
DDSEDGNYNPFEHRKVEHPTSDLETFVHLLKGSLGSGILAMPMAFSHAGL
WFGLVATFAVGTLCTYCVHILVKCAHILCRRRKIPMMGFADVAEQAFLDG
PPALNRWSRFIRFMVNTFLVIDLLGCCCIYLVFVATNVEQVVRVYMETEL
SIRVWIMIVTAPLIFMCLVRNLKFLTPFSMIANILMFVGIVITFIYMFSD
IPAPVERPGIVSVTEWPLFFGTVIFALEGIGVVMSLENDMKNPSHFIGCP
SVLNFGMGLVIALYTLVGFFGFLKYGPETQASITLNLPLEDKLAQSVKLM
IAIAIFFTFTLQFYVPVTILWKGLEHKIRPEKQNISEYGLRVFLVLLCGG
IAVALPNLGPFISLIGAVCLSTLGMIVPATIELAVYHEDPGYGRFNWRLW
KNSGLILFGVVGFVAGTYVSIIEFHAEFSSGHASFLDH

BO28721.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 07:21:21
Subject Length Description Subject Range Query Range Score Percent Strand
CG43693-PC 482 CG43693-PC 1..482 1..482 2514 100 Plus
CG43693-PG 572 CG43693-PG 112..572 22..482 2403 99.8 Plus
CG43693-PB 502 CG43693-PB 42..502 22..482 2403 99.8 Plus
CG43693-PA 502 CG43693-PA 42..502 22..482 2403 99.8 Plus
CG43693-PD 490 CG43693-PD 30..490 22..482 2403 99.8 Plus