Clone BO28722 Report

Search the DGRC for BO28722

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:287
Well:22
Vector:pDNR-Dual
Associated Gene/TranscriptIndy-RB
Protein status:BO28722.pep: Imported from assembly
Sequenced Size:1804

Clone Sequence Records

BO28722.complete Sequence

1804 bp assembled on 2011-09-19

GenBank Submission: KX793762

> BO28722.complete
GAAGTTATCAGTCGACATGGCGACCGAAACTACAAAAATGATCTACACGC
CACCGCCACTGGACATCAAAATGGAAATTGAAATTGGCGAACAACCCCAG
CCTCCGGTGAAGTGCTCCAACTTCTTCGCTAACCACTGGAAGGGATTGGT
TGTGTTCCTGGTGCCGCTGCTATGTCTGCCTGTTATGCTGCTAAACGAAG
GCGCCGAATTTCGGTGCATGTACCTCCTTTTGGTAATGGCCATATTTTGG
GTTACGGAAGCCTTGCCTCTCTATGTGACGTCCATGATACCGATTGTGGC
CTTCCCAATAATGGGTATAATGAGCTCGGATCAGACTTGCCGCTTGTACT
TCAAGGATACGCTGGTGATGTTCATGGGCGGCATTATGGTCGCCCTGGCT
GTGGAGTACTGTAATCTACACAAACGTCTTGCCTTGAGGGTAATCCAGAT
CGTGGGCTGCAGTCCCCGCAGATTACACTTTGGCCTCATCATGGTTACAA
TGTTTTTGAGCATGTGGATTTCGAACGCCGCCTGTACTGCCATGATGTGT
CCGATTATCCAAGCCGTGCTGGAGGAGCTGCAGGCTCAGGGTGTCTGCAA
AATCAACCATGAGCCTCAATACCAAATCGTTGGAGGCAACAAGAAAAACA
ACGAGGATGAGCCACCATACCCCACCAAGATCACTCTGTGCTACTATCTG
GGCATTGCCTACGCCTCCTCGCTGGGTGGCTGTGGAACCATCATCGGAAC
TGCCACCAATCTTACCTTCAAGGGCATCTACGAGGCTCGTTTCAAGAACT
CCACCGAACAGATGGACTTCCCCACCTTCATGTTCTACTCGGTGCCATCC
ATGTTGGTCTACACCTTGCTGACATTCGTGTTCCTGCAATGGCACTTCAT
GGGTCTGTGGCGTCCCAAGAGCAAGGAGGCACAGGAAGTCCAGAGGGGAC
GAGAGGGCGCCGATGTCGCCAAAAAGGTTATCGATCAGCGCTACAAGGAT
CTGGGTCCCATGTCCATTCACGAGATCCAAGTGATGATTCTGTTCATTTT
TATGGTTGTGATGTACTTCACCCGCAAGCCCGGCATCTTTTTGGGATGGG
CCGATTTGCTGAATTCCAAGGACATTCGTAACTCTATGCCCACTATTTTT
GTCGTCGTCATGTGCTTCATGCTGCCCGCCAATTATGCTTTCCTACGCTA
CTGCACCAGACGCGGTGGTCCAGTGCCCACGGGTCCCACTCCATCGCTGA
TCACCTGGAAGTTCATCCAGACCAAGGTGCCATGGGGTCTGGTGTTCCTG
CTTGGCGGTGGCTTCGCTTTGGCCGAAGGCAGCAAGCAGAGCGGCATGGC
CAAGCTGATTGGCAATGCTCTGATTGGATTGAAGGTTCTGCCCAACTCTG
TCCTCTTACTGGTGGTCATCCTGGTGGCTGTGTTCCTGACCGCCTTCAGC
TCCAATGTGGCGATTGCCAACATTATTATTCCCGTTCTGGCCGAGATGTC
CCTGGCCATTGAGATCCATCCTCTGTACCTGATCCTGCCCGCTGGCTTGG
CCTGCAGTATGGCCTTCCACCTGCCGGTTAGTACTCCGCCCAACGCTTTG
GTTGCTGGCTATGCCAACATTAGGACGAAGGACATGGCCATTGCTGGAAT
CGGTCCGACCATCATTACCATCATCACCCTGTTTGTTTTCTGCCAAACCT
GGGGCCTGGTCGTCTATCCGAACCTTAACTCGTTCCCCGAATGGGCTCAG
ATTTATGCCGCGGCAGCACTGGGAAACAAGACGCACGCAAGCTTTCTAGA
CCAT

BO28722.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 10:17:33
Subject Length Description Subject Range Query Range Score Percent Strand
Indy-RB 1773 CG3979-PB 1..1770 17..1786 8850 100 Plus
Indy-RD 1719 CG3979-PD 1..1716 71..1786 8580 100 Plus
Indy-RA 1719 CG3979-PA 1..1716 71..1786 8580 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 10:17:34
Subject Length Description Subject Range Query Range Score Percent Strand
Indy-RB 2572 CG3979-RB 208..1978 16..1786 8855 100 Plus
Indy-RC 2600 CG3979-RC 260..2006 40..1786 8735 100 Plus
Indy-RD 2581 CG3979-RD 242..1987 41..1786 8730 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 10:17:31
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 18830275..18830734 1120..661 2300 100 Minus
3L 28110227 3L 18829579..18829963 1498..1114 1910 99.7 Minus
3L 28110227 3L 18829226..18829514 1786..1498 1445 100 Minus
3L 28110227 3L 18830839..18831035 661..465 970 99.5 Minus
3L 28110227 3L 18831093..18831242 471..322 750 100 Minus
3L 28110227 3L 18831494..18831621 206..79 640 100 Minus
3L 28110227 3L 18831311..18831427 322..206 585 100 Minus
3L 28110227 3L 18831947..18831985 78..40 195 100 Minus
Blast to na_te.dros performed 2014-11-27 10:17:32
Subject Length Description Subject Range Query Range Score Percent Strand
Rt1c 5443 Rt1c RT1C 5443bp 1564..1616 1741..1796 120 71.4 Plus

BO28722.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-09-19 10:42:05 Download gff for BO28722.complete
Subject Subject Range Query Range Percent Splice Strand
Indy-RB 202..1971 17..1788 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:37:40 Download gff for BO28722.complete
Subject Subject Range Query Range Percent Splice Strand
Indy-RB 209..1978 17..1788 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:17:59 Download gff for BO28722.complete
Subject Subject Range Query Range Percent Splice Strand
Indy-RB 209..1978 17..1788 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 11:17:59 Download gff for BO28722.complete
Subject Subject Range Query Range Percent Splice Strand
3L 18846036..18846059 17..40 100   Minus
3L 18831947..18831984 41..78 100 <- Minus
3L 18831495..18831621 79..205 100 <- Minus
3L 18831311..18831427 206..322 100 <- Minus
3L 18831093..18831241 323..471 100 <- Minus
3L 18830840..18831028 472..660 100 <- Minus
3L 18830276..18830734 661..1119 100 <- Minus
3L 18829579..18829957 1120..1498 100 <- Minus
3L 18829224..18829513 1499..1788 99 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:37:40 Download gff for BO28722.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 18839136..18839159 17..40 100   Minus
arm_3L 18825047..18825084 41..78 100 <- Minus
arm_3L 18824595..18824721 79..205 100 <- Minus
arm_3L 18824411..18824527 206..322 100 <- Minus
arm_3L 18824193..18824341 323..471 100 <- Minus
arm_3L 18823940..18824128 472..660 100 <- Minus
arm_3L 18823376..18823834 661..1119 100 <- Minus
arm_3L 18822679..18823057 1120..1498 100 <- Minus
arm_3L 18822324..18822613 1499..1788 99 <- Minus

BO28722.pep Sequence

Translation from 16 to 1804

> BO28722.pep
MATETTKMIYTPPPLDIKMEIEIGEQPQPPVKCSNFFANHWKGLVVFLVP
LLCLPVMLLNEGAEFRCMYLLLVMAIFWVTEALPLYVTSMIPIVAFPIMG
IMSSDQTCRLYFKDTLVMFMGGIMVALAVEYCNLHKRLALRVIQIVGCSP
RRLHFGLIMVTMFLSMWISNAACTAMMCPIIQAVLEELQAQGVCKINHEP
QYQIVGGNKKNNEDEPPYPTKITLCYYLGIAYASSLGGCGTIIGTATNLT
FKGIYEARFKNSTEQMDFPTFMFYSVPSMLVYTLLTFVFLQWHFMGLWRP
KSKEAQEVQRGREGADVAKKVIDQRYKDLGPMSIHEIQVMILFIFMVVMY
FTRKPGIFLGWADLLNSKDIRNSMPTIFVVVMCFMLPANYAFLRYCTRRG
GPVPTGPTPSLITWKFIQTKVPWGLVFLLGGGFALAEGSKQSGMAKLIGN
ALIGLKVLPNSVLLLVVILVAVFLTAFSSNVAIANIIIPVLAEMSLAIEI
HPLYLILPAGLACSMAFHLPVSTPPNALVAGYANIRTKDMAIAGIGPTII
TIITLFVFCQTWGLVVYPNLNSFPEWAQIYAAAALGNKTHASFLDH

BO28722.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 07:58:55
Subject Length Description Subject Range Query Range Score Percent Strand
Indy-PB 590 CG3979-PB 1..590 1..590 3089 100 Plus
Indy-PD 572 CG3979-PD 1..572 19..590 2994 100 Plus
Indy-PA 572 CG3979-PA 1..572 19..590 2994 100 Plus
Indy-PC 572 CG3979-PC 1..572 19..590 2994 100 Plus
CG33934-PE 556 CG33934-PE 16..555 32..577 1531 51.3 Plus