Clone BO28724 Report

Search the DGRC for BO28724

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:287
Well:24
Vector:pDNR-Dual
Associated Gene/TranscriptVha100-1-RB
Protein status:BO28724.pep: Imported from assembly
Sequenced Size:2542

Clone Sequence Records

BO28724.complete Sequence

2542 bp assembled on 2011-09-19

GenBank Submission: KX794204

> BO28724.complete
GAAGTTATCAGTCGACATGGGTTCCCTATTCCGCAGCGAGGAAATGGCGC
TGTGCCAGCTGTTCCTGCAGAGCGAGGCGGCCTACGCCTGCGTCTCCGAG
TTGGGAGAACTGGGATTGGTCCAGTTCCGAGATCTCAATCCCGATGTCAA
CGCTTTCCAGAGGAAGTTCGTCAACGAGGTGCGCCGCTGCGATGAGATGG
AGCGCAAGCTGCGTTACCTGGAGAAGGAGATCAAGAAGGACGGCATCCCC
ATGTTGGACACCGGGGAGAGTCCCGAGGCCCCGCAGCCCCGCGAGATGAT
CGACCTGGAGGCCACCTTTGAGAAGCTGGAGAACGAGCTGAGGGAGGTGA
ATCAGAACGCCGAGGCCCTGAAGCGCAACTTTCTGGAGCTGACCGAGCTG
AAGCATATTTTGCGCAAAACCCAAGTGTTCTTCGATGAGCAAGAAGGCGG
CGTAAACCAAACGACCGAGTCGATGACCCGCGCCTTGATCACGGACGAGG
CGCGCACCGCTGGTGCCTCCATGGGTCCCGTACAGCTCGGCTTCGTGGCT
GGCGTCATCCTGAGGGAGCGACTGCCGGCCTTCGAGCGGATGTTGTGGCG
CGCCTGCAGGGGTAACGTCTTCCTGCGACAGGCGATGATTGAGACGCCGC
TGGAGGATCCCACCAATGGCGACCAGGTGCACAAGTCCGTGTTTATAATC
TTCTTCCAGGGTGACCAGCTGAAGACGCGCGTCAAGAAGATCTGCGAGGG
CTTCCGGGCCACGCTCTATCCTTGCCCTGAAGCTCCAGCCGATCGGCGAG
AGATGGCCATGGGTGTGATGACTCGCATCGAAGATCTGAACACCGTGCTC
GGCCAGACGCAGGACCATCGCCATCGTGTGCTGGTCGCTGCGGCCAAGAA
TCTTAAGAACTGGTTCGTCAAGGTGCGCAAGATAAAGGCCATCTACCATA
CGCTGAATCTCTTCAATCTGGACGTGACCCAGAAGTGTCTGATCGCCGAG
TGCTGGGTACCGCTGCTGGACATTGAAACCATCCAGCTGGCCTTGCGCCG
CGGAACCGAAAGATCGGGATCGTCGGTGCCGCCAATTCTCAACCGGATGC
AGACGTTCGAGAATCCACCGACCTACAATCGAACGAATAAGTTTACCAAG
GCCTTTCAGGCATTGATCGATGCCTATGGCGTGGCCAGCTATCGGGAGAT
GAATCCGGCACCCTACACGATCATCACCTTCCCCTTCCTGTTCGCCGTGA
TGTTTGGAGATTTGGGCCACGGAGCTATCATGGCGCTCTTTGGTCTCTGG
ATGATTCGAAAGGAGAAGGGACTGGCGGCTCAGAAGACGGACAACGAGAT
CTGGAACATATTCTTTGGCGGACGGTACATCATCTTCCTCATGGGCGTCT
TCTCCATGTACACGGGTCTTATATACAACGATATATTCTCCAAGTCGCTG
AATATCTTTGGATCGCATTGGCACTTATCCTACAACAAGTCCACCGTGAT
GGAGAACAAGTTCCTGCAGTTGAGCCCGAAAGGCGACTACGAGGGCGCTC
CGTATCCGTTCGGCATGGATCCCATTTGGCAGGTGGCGGGAGCCAATAAG
ATCATCTTCCACAACGCTTACAAGATGAAGATCTCGATCATTTTCGGTGT
TATTCACATGATCTTCGGTGTGGTGATGAGCTGGCACAATCATACGTATT
TCAGAAACAGGATCTCCCTGCTCTACGAGTTCATTCCCCAGCTGGTCTTC
CTGCTGCTGCTTTTCTTCTACATGGTTTTGTTGATGTTCATCAAGTGGAT
CAAGTTTGCCGCCACCAATGATAAGCCCTACTCCGAAGCCTGTGCGCCTT
CAATCCTGATCACCTTTATCGACATGGTGCTTTTTAACACGCCCAAGCCA
CCTCCGGAGAACTGTGAAACCTATATGTTCATGGGCCAGCACTTTATCCA
GGTGTTATTCGTCCTGGTTGCCGTCGGCTGCATTCCCGTAATGTTGCTGG
CCAAGCCGCTGCTCATCATGCAGGCCCGCAAGCAGGCGAACGTACAGCCC
ATTGCAGGAGCAACTTCAGATGCAGAAGCCGGCGGCGTGTCCAATAGCGG
CTCACACGGTGGTGGCGGTGGCCATGAGGAGGAAGAGGAGCTCTCTGAGA
TCTTCATTCACCAGAGCATCCACACCATCGAGTACGTCCTAGGTTCGGTA
TCCCACACCGCTTCCTATCTGCGATTGTGGGCGCTTTCCTTGGCCCATGC
CCAGTTGGCTGAGGTGCTGTGGACCATGGTCCTATCGATTGGCTTGAAGC
AGGAAGGGCCGGTGGGTGGCATTGTATTGACCTGCGTGTTTGCCTTCTGG
GCCATTCTCACCGTTGGCATTCTGGTACTCATGGAGGGCTTGTCTGCCTT
CCTGCACACCCTGCGTCTCCATTGGGTCGAGTTCCAGAGCAAGTTCTACA
AGGGCCAGGGTTACGCCTTCCAACCCTTCTCGTTTGATGCCATCATAGAA
AACGGAGCTGCCGCCGCCGAGGAGGCAAGCTTTCTAGACCAT

BO28724.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 10:26:30
Subject Length Description Subject Range Query Range Score Percent Strand
Vha100-1-RK 2511 CG1709-PK 1..2508 17..2524 12525 100 Plus
Vha100-1-RD 2511 CG1709-PD 1..2508 17..2524 12525 100 Plus
Vha100-1-RB 2511 CG1709-PB 1..2508 17..2524 12525 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 10:26:31
Subject Length Description Subject Range Query Range Score Percent Strand
Vha100-1-RK 2902 CG1709-RK 103..2610 17..2524 12525 100 Plus
Vha100-1-RD 3009 CG1709-RD 205..2712 17..2524 12525 100 Plus
Vha100-1-RB 2907 CG1709-RB 103..2610 17..2524 12525 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 10:26:28
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 29135262..29136417 668..1823 5765 99.9 Plus
3R 32079331 3R 29136482..29136702 1824..2044 1105 100 Plus
3R 32079331 3R 29137076..29137286 2042..2252 1055 100 Plus
3R 32079331 3R 29132126..29132303 134..311 890 100 Plus
3R 32079331 3R 29137352..29137524 2253..2425 865 100 Plus
3R 32079331 3R 29132374..29132504 309..439 655 100 Plus
3R 32079331 3R 29135048..29135176 540..668 645 100 Plus
3R 32079331 3R 29131709..29131825 17..133 585 100 Plus
3R 32079331 3R 29133859..29133961 438..540 515 100 Plus
3R 32079331 3R 29137579..29137683 2420..2524 510 99 Plus
2L 23513712 2L 11741549..11741776 15..242 330 76.3 Plus
3R 32079331 3R 18393092..18393190 247..149 315 87.9 Minus
3R 32079331 3R 18390664..18390771 2479..2372 285 84.3 Minus
2L 23513712 2L 11742868..11742996 1346..1474 270 80.6 Plus
2R 25286936 2R 18909062..18909162 2447..2347 250 83.2 Minus
3R 32079331 3R 18392349..18392428 1008..929 235 86.2 Minus
3R 32079331 3R 18388331..18388441 1273..1163 225 80.2 Minus
3R 32079331 3R 18391886..18392011 1471..1346 225 78.6 Minus
2R 25286936 2R 18910296..18910374 1273..1195 215 84.8 Minus
3R 32079331 3R 18391691..18391807 1672..1553 205 80 Minus
2L 23513712 2L 11743624..11743709 2147..2232 205 82.6 Plus
3R 32079331 3R 18392085..18392193 1272..1164 185 78 Minus
Blast to na_te.dros performed 2014-11-27 10:26:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6819..6865 1788..1742 127 74.5 Minus

BO28724.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-09-19 10:42:06 Download gff for BO28724.complete
Subject Subject Range Query Range Percent Splice Strand
Vha100-1-RG 811..2795 540..2526 99   Plus
Vha100-1-RG 246..768 17..539 100 -> Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:38:43 Download gff for BO28724.complete
Subject Subject Range Query Range Percent Splice Strand
Vha100-1-RB 103..2610 17..2526 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:21:55 Download gff for BO28724.complete
Subject Subject Range Query Range Percent Splice Strand
Vha100-1-RB 103..2610 17..2526 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 11:21:55 Download gff for BO28724.complete
Subject Subject Range Query Range Percent Splice Strand
3R 29137584..29137683 2425..2526 98   Plus
3R 29137352..29137523 2253..2424 100 -> Plus
3R 29137076..29137286 2042..2252 100 -> Plus
3R 29136482..29136699 1824..2041 100 -> Plus
3R 29135262..29136417 668..1823 99 -> Plus
3R 29135049..29135175 541..667 100 -> Plus
3R 29133861..29133961 440..540 100 -> Plus
3R 29132376..29132504 311..439 100 -> Plus
3R 29132126..29132302 134..310 100 -> Plus
3R 29131709..29131825 17..133 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:38:43 Download gff for BO28724.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 24963306..24963405 2425..2526 98   Plus
arm_3R 24963074..24963245 2253..2424 100 -> Plus
arm_3R 24962798..24963008 2042..2252 100 -> Plus
arm_3R 24962204..24962421 1824..2041 100 -> Plus
arm_3R 24960984..24962139 668..1823 99 -> Plus
arm_3R 24960771..24960897 541..667 100 -> Plus
arm_3R 24959583..24959683 440..540 100 -> Plus
arm_3R 24958098..24958226 311..439 100 -> Plus
arm_3R 24957848..24958024 134..310 100 -> Plus
arm_3R 24957431..24957547 17..133 100 -> Plus

BO28724.pep Sequence

Translation from 16 to 2542

> BO28724.pep
MGSLFRSEEMALCQLFLQSEAAYACVSELGELGLVQFRDLNPDVNAFQRK
FVNEVRRCDEMERKLRYLEKEIKKDGIPMLDTGESPEAPQPREMIDLEAT
FEKLENELREVNQNAEALKRNFLELTELKHILRKTQVFFDEQEGGVNQTT
ESMTRALITDEARTAGASMGPVQLGFVAGVILRERLPAFERMLWRACRGN
VFLRQAMIETPLEDPTNGDQVHKSVFIIFFQGDQLKTRVKKICEGFRATL
YPCPEAPADRREMAMGVMTRIEDLNTVLGQTQDHRHRVLVAAAKNLKNWF
VKVRKIKAIYHTLNLFNLDVTQKCLIAECWVPLLDIETIQLALRRGTERS
GSSVPPILNRMQTFENPPTYNRTNKFTKAFQALIDAYGVASYREMNPAPY
TIITFPFLFAVMFGDLGHGAIMALFGLWMIRKEKGLAAQKTDNEIWNIFF
GGRYIIFLMGVFSMYTGLIYNDIFSKSLNIFGSHWHLSYNKSTVMENKFL
QLSPKGDYEGAPYPFGMDPIWQVAGANKIIFHNAYKMKISIIFGVIHMIF
GVVMSWHNHTYFRNRISLLYEFIPQLVFLLLLFFYMVLLMFIKWIKFAAT
NDKPYSEACAPSILITFIDMVLFNTPKPPPENCETYMFMGQHFIQVLFVL
VAVGCIPVMLLAKPLLIMQARKQANVQPIAGATSDAEAGGVSNSGSHGGG
GGHEEEEELSEIFIHQSIHTIEYVLGSVSHTASYLRLWALSLAHAQLAEV
LWTMVLSIGLKQEGPVGGIVLTCVFAFWAILTVGILVLMEGLSAFLHTLR
LHWVEFQSKFYKGQGYAFQPFSFDAIIENGAAAAEEASFLDH

BO28724.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 07:58:58
Subject Length Description Subject Range Query Range Score Percent Strand
Vha100-1-PK 836 CG1709-PK 1..836 1..836 4363 100 Plus
Vha100-1-PD 836 CG1709-PD 1..836 1..836 4363 100 Plus
Vha100-1-PB 836 CG1709-PB 1..836 1..836 4363 100 Plus
Vha100-1-PG 850 CG1709-PG 1..850 1..836 4338 98.4 Plus
Vha100-1-PJ 852 CG1709-PJ 1..852 1..836 4325 98.1 Plus