Clone BO28731 Report

Search the DGRC for BO28731

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:287
Well:31
Vector:pDNR-Dual
Associated Gene/TranscriptEb1-RF
Protein status:BO28731.pep: Imported from assembly
Sequenced Size:925

Clone Sequence Records

BO28731.complete Sequence

925 bp assembled on 2011-08-24

GenBank Submission: KX793909

> BO28731.complete
GAAGTTATCAGTCGACATGGCTGTAAACGTCTACTCCACAAATGTGACGT
CAGAGAATCTCTCGCGCCACGATATGCTAGCTTGGGTTAACGATTGCCTC
CAGTCGCAATTCTCAAAAATCGAGGAGCTCTGCACAGGTGCAGCTTACTG
TCAGTTCATGGACATGCTGTTTCCCAATTCAGTGCCAGTAAAGCGTGTCA
AATTTCGTACCAATCTGGAGCACGAGTACATACAGAACTTCAAGATATTG
CAGGCGGGCTTCAAGAAGATGTCTGTGGATAAGATCATTCCAGTTGATAA
ACTGATTAAGGGACGCTTTCAAGACAACTTTGAGTTCCTTCAATGGTTTA
AAAAATTCTTCGACGCCAATTACGACGGTCGCGAGTACGACCCCGTGGCT
CAGCGGGGCGGAGTCAAGCTGGGCAATGGCAACGGACACGGCAGCAACGG
AGGCAGTGGCGTGGGCAGCAGCAACAACGATCTCCATCTGATGCACCGGC
GACCATTGCAGGCTCCAGCTTCTGGCGGACGAATGCCAGCACGGGTCATC
GCTTCAACTGCAGTATCCAAGGTGCTGCCGCGCACGAACAACGCAGCCCC
AGCGAGCAGAATAAACGCCTGTGCCAACAGCACGGGCACGGTCAAGAAGA
ACGACGTGAGCAATTCGGTCAACAATCAACAAATAGAAGAGATGTCAAAT
CAGGTGATGGATATGCGCATAAACCTGGAGGGATTGGAAAAGGAGCGAGA
CTTTTACTTCTCTAAGTTGCGGGATATTGAAATTCTTTGCCAAGAAGCCG
ATGACGCCGAGGCGCATCCGATCATACAAAAGATTTTGGACATCTTATAT
GCGACTGAGGATGGTTTTGCGCCGCCTGACGATGCACCACCAGAGGACGA
GGAGTATGCAAGCTTTCTAGACCAT

BO28731.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 06:40:57
Subject Length Description Subject Range Query Range Score Percent Strand
Eb1-RF 894 CG3265-PF 1..891 17..907 4455 100 Plus
Eb1-RG 876 CG3265-PG 527..873 561..907 1735 100 Plus
Eb1-RA 876 CG3265-PA 527..873 561..907 1735 100 Plus
Eb1-RG 876 CG3265-PG 1..359 17..375 1525 95 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 06:40:58
Subject Length Description Subject Range Query Range Score Percent Strand
Eb1-RF 1891 CG3265-RF 194..1086 15..907 4465 100 Plus
Eb1-RG 2043 CG3265-RG 629..975 561..907 1735 100 Plus
Eb1-RA 1873 CG3265-RA 722..1068 561..907 1735 100 Plus
Eb1-RG 2043 CG3265-RG 101..461 15..375 1535 95 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 06:40:55
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 6753225..6753503 282..560 1395 100 Plus
3L 28110227 3L 25202057..25202409 15..375 1150 89.2 Plus
3L 28110227 3L 25202577..25202847 561..833 1090 94.1 Plus
2R 25286936 2R 6752841..6752988 136..283 740 100 Plus
2R 25286936 2R 6754701..6754847 560..706 735 100 Plus
2R 25286936 2R 6752662..6752786 15..139 625 100 Plus
2R 25286936 2R 6754894..6754981 699..786 440 100 Plus
2R 25286936 2R 6755045..6755118 787..860 370 100 Plus
2R 25286936 2R 6755183..6755232 858..907 250 100 Plus
3L 28110227 3L 7767870..7768147 397..120 250 72.7 Minus
2R 25286936 2R 6754204..6754271 308..375 205 86.8 Plus
2R 25286936 2R 18852347..18852410 364..301 185 85.9 Minus
Blast to na_te.dros performed on 2014-11-27 06:40:56 has no hits.

BO28731.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-08-24 14:34:30 Download gff for BO28731.complete
Subject Subject Range Query Range Percent Splice Strand
Eb1-RF 231..1121 17..909 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 04:50:37 Download gff for BO28731.complete
Subject Subject Range Query Range Percent Splice Strand
Eb1-RF 196..1086 17..909 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 07:51:36 Download gff for BO28731.complete
Subject Subject Range Query Range Percent Splice Strand
Eb1-RF 196..1086 17..909 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 07:51:36 Download gff for BO28731.complete
Subject Subject Range Query Range Percent Splice Strand
2R 6755185..6755232 860..909 96   Plus
2R 6755045..6755117 787..859 100 -> Plus
2R 6754899..6754981 704..786 100 -> Plus
2R 6754702..6754844 561..703 100 -> Plus
2R 6753227..6753503 284..560 100 -> Plus
2R 6752843..6752988 138..283 100 -> Plus
2R 6752664..6752784 17..137 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 04:50:37 Download gff for BO28731.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 2642690..2642737 860..909 96   Plus
arm_2R 2642550..2642622 787..859 100 -> Plus
arm_2R 2642404..2642486 704..786 100 -> Plus
arm_2R 2642207..2642349 561..703 100 -> Plus
arm_2R 2640732..2641008 284..560 100 -> Plus
arm_2R 2640348..2640493 138..283 100 -> Plus
arm_2R 2640169..2640289 17..137 100 -> Plus

BO28731.pep Sequence

Translation from 16 to 925

> BO28731.pep
MAVNVYSTNVTSENLSRHDMLAWVNDCLQSQFSKIEELCTGAAYCQFMDM
LFPNSVPVKRVKFRTNLEHEYIQNFKILQAGFKKMSVDKIIPVDKLIKGR
FQDNFEFLQWFKKFFDANYDGREYDPVAQRGGVKLGNGNGHGSNGGSGVG
SSNNDLHLMHRRPLQAPASGGRMPARVIASTAVSKVLPRTNNAAPASRIN
ACANSTGTVKKNDVSNSVNNQQIEEMSNQVMDMRINLEGLEKERDFYFSK
LRDIEILCQEADDAEAHPIIQKILDILYATEDGFAPPDDAPPEDEEYASF
LDH

BO28731.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 07:21:40
Subject Length Description Subject Range Query Range Score Percent Strand
Eb1-PF 297 CG3265-PF 1..297 1..297 1560 100 Plus
Eb1-PE 290 CG3265-PE 1..290 1..297 1269 84.4 Plus
Eb1-PG 291 CG3265-PG 1..291 1..297 1265 83.7 Plus
Eb1-PA 291 CG3265-PA 1..291 1..297 1265 83.7 Plus
Eb1-PD 291 CG3265-PD 1..291 1..297 1265 83.7 Plus