Clone BO28732 Report

Search the DGRC for BO28732

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:287
Well:32
Vector:pDNR-Dual
Associated Gene/TranscriptCG9510-RB
Protein status:BO28732.pep: Imported from assembly
Sequenced Size:1441

Clone Sequence Records

BO28732.complete Sequence

1441 bp assembled on 2011-08-24

GenBank Submission: KX800145

> BO28732.complete
GAAGTTATCAGTCGACATGACCCAGATCCCCGAGAGCTGTTATAAGATGT
GGGGTGGTAGGTTCACCGAGGGGCCGCATGAGGCTCTCCATTCGCTGAAT
AACAGCCTGCCCTACGATTCTCGCCTCTATGCGGATGATTTGGACGCCAG
CAAGGCGTATGCAGAGGCACTCCATCGAGCTGGTCTCATCAACTCAGCCG
AGGCGGATAAGTTGGTAAAGAATCTGGAGCTGTTGCGATTCGATTGGATC
GAGGGAACTGTGAAGATTCTACCCGGTGACGAGGATGTGCACACGGTGAA
CGAGCGATTGCTGGTGGAGATTACCGGCGAACTGGGCCAGCGGCTTCACA
CGGGCAGAAGCAGAAATGACCAGGTGGTCACGGACATGAAGCTATGGCTT
CGCAAGGCCATTCGTGAGACCTTGGGCCGGCTGAGTGGCATCATTGAAAC
TGCCACCAGGCAGGCGGAACTCCACCTGGGCGTCCTCATGCCAGGATACA
CGCATCTGCAGCGGGCCCAGACCGTTCAGTTCTCCCACTGGCTGCTCTCG
CACGCGTTTGCATTAAGGGAAGATGGCCAGCGGCTGTTGGAGCTAAGGGA
TCGGGCGAATGTCCTGCCCCTTGGAAGTGGCGCTCTGGCGGGAAATCCCC
TTGGCATCGATCGTTTGTGGCTGGCCGAGAGGCTGGGATTCTCGGGTGTC
ACAGCCAACAGCATGCACGCCGTGGGAGATCGAGATTTTGTAGTTGACTT
CATCTACTGCTGCTCTATGGTGAGCCTGCATCTGTCCCGATTGGCGGAGG
ATTTGATCATCTACAGTACCAAGGAGTTCGACTTCATCAAACTGGCCGAT
GGCTTTTCCAGTGGCAGCAGCCTGATGCCTCAGAAAAGGAATCCGGACAG
CTTGGAGCTGATTCGCGGCATGGCCGGTGTGATCACCGCCAATCTGACGG
GCATAATGATGACCATTAAGGGCACTCCGTCCACCTACAACAAGGACTTG
CAGTACGACAAGCAATTCTGCTTCCAGTCCTTCGACAAGCTGTCCCAAGT
GCTCGAGGTTACCGATGGTGTCCTACAGACGATTCAGGTCAAGCAGGAAT
CAATGGAGGCGGCACTTAGCACAGACATGCTGGCCACTGACTGGGCCTAC
TATCTGGTGAAGAAGGGGGTTCCATTCCGCCAGGCGCATCACATTATCGG
TCGCGTGGTCTCGGAGGCCGAAAAGCGCGGTGTGGACATCACTGATTTGC
CGCTGGGAGATCTCCAGAAATTCAGTCCTTTATTTGGATCGGATATCGTT
GCAGTGGCGGACTACTCCAACAATGTCCAGCAATATAATGCGATTGGTGG
AACCGCCAGTAGCAGCATCGTGGAACAACTGCGTTTGCTCAAGAAGTGCG
CAAGGGATTTGGCCAAACAGTCGGCAAGCTTTCTAGACCAT

BO28732.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 06:41:26
Subject Length Description Subject Range Query Range Score Percent Strand
CG9510-RD 1410 CG9510-PD 1..1407 17..1423 7035 100 Plus
CG9510-RC 1410 CG9510-PC 1..1407 17..1423 7035 100 Plus
CG9510-RB 1410 CG9510-PB 1..1407 17..1423 7035 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 06:41:27
Subject Length Description Subject Range Query Range Score Percent Strand
CG9510-RD 1640 CG9510-RD 39..1446 16..1423 7040 100 Plus
CG9510-RC 1922 CG9510-RC 381..1788 16..1423 7040 100 Plus
CG9510-RB 1580 CG9510-RB 39..1446 16..1423 7040 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 06:41:25
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 8940994..8941725 747..16 3645 99.9 Minus
2L 23513712 2L 8940254..8940658 1145..741 2025 100 Minus
2L 23513712 2L 8939919..8940198 1423..1144 1400 100 Minus
Blast to na_te.dros performed on 2014-11-27 06:41:25 has no hits.

BO28732.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-08-24 14:34:30 Download gff for BO28732.complete
Subject Subject Range Query Range Percent Splice Strand
CG9515-RA 1257..2663 17..1425 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 04:50:52 Download gff for BO28732.complete
Subject Subject Range Query Range Percent Splice Strand
CG9510-RB 40..1446 17..1425 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 07:51:50 Download gff for BO28732.complete
Subject Subject Range Query Range Percent Splice Strand
CG9510-RB 40..1446 17..1425 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 07:51:50 Download gff for BO28732.complete
Subject Subject Range Query Range Percent Splice Strand
2L 8940998..8941724 17..743 100   Minus
2L 8940255..8940655 744..1144 100 <- Minus
2L 8939917..8940197 1145..1425 99 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 04:50:52 Download gff for BO28732.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 8940998..8941724 17..743 100   Minus
arm_2L 8940255..8940655 744..1144 100 <- Minus
arm_2L 8939917..8940197 1145..1425 99 <- Minus

BO28732.pep Sequence

Translation from 16 to 1441

> BO28732.pep
MTQIPESCYKMWGGRFTEGPHEALHSLNNSLPYDSRLYADDLDASKAYAE
ALHRAGLINSAEADKLVKNLELLRFDWIEGTVKILPGDEDVHTVNERLLV
EITGELGQRLHTGRSRNDQVVTDMKLWLRKAIRETLGRLSGIIETATRQA
ELHLGVLMPGYTHLQRAQTVQFSHWLLSHAFALREDGQRLLELRDRANVL
PLGSGALAGNPLGIDRLWLAERLGFSGVTANSMHAVGDRDFVVDFIYCCS
MVSLHLSRLAEDLIIYSTKEFDFIKLADGFSSGSSLMPQKRNPDSLELIR
GMAGVITANLTGIMMTIKGTPSTYNKDLQYDKQFCFQSFDKLSQVLEVTD
GVLQTIQVKQESMEAALSTDMLATDWAYYLVKKGVPFRQAHHIIGRVVSE
AEKRGVDITDLPLGDLQKFSPLFGSDIVAVADYSNNVQQYNAIGGTASSS
IVEQLRLLKKCARDLAKQSASFLDH

BO28732.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 07:21:41
Subject Length Description Subject Range Query Range Score Percent Strand
CG9510-PD 469 CG9510-PD 1..469 1..469 2404 100 Plus
CG9510-PC 469 CG9510-PC 1..469 1..469 2404 100 Plus
CG9510-PB 469 CG9510-PB 1..469 1..469 2404 100 Plus