Clone BO28733 Report

Search the DGRC for BO28733

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:287
Well:33
Vector:pDNR-Dual
Associated Gene/TranscriptCG30403-RB
Protein status:BO28733.pep: Imported from assembly
Sequenced Size:940

Clone Sequence Records

BO28733.complete Sequence

940 bp assembled on 2011-08-24

GenBank Submission: KX794570

> BO28733.complete
GAAGTTATCAGTCGACATGAACAGTGCCGTACCGCCCGGCGTGTTGGGAC
TACCCTATCGATTTTCGGATGAGCGTACGGTCAAGTTCGTAGAGCTTTAC
GGCCGGGAACCTTGTCTCTGGAACAAGCGACCATATTTGCGACGAGCTCG
AAGCGCCGCCTATCGGCGAATTCAGTCCGGGATCAATGCTGATATTGAAC
CATATGAGTCAGGTCTTACCATCCAGGGCGTAAAGATGAAGATCAAGAAT
CTTCGTACTGGGTACCACCAGGAGCTAAAGAAGATCCGAACTATTCCGGG
ATATCAGCCAAAGACGCCCTGGTTTGCCCCACTTCACGGGTTTTTGGCAG
AGTTCTTGGACACGAATGAGTTGGAAACATCAATTCCTCAACTAAAGCGC
CTACAGATTCGACTTACCAGACTGAAGCCGATTAAGATTCAGACGGAGAT
TAAGCCAGATCCCGATGACTTGTCAGTCCCCGATAGGCCGTTGGATGCTA
CACCCTCTTCCTTATTTACCGTTCTGCCAGCACCTATGCCCGTGGAGGAG
CCTCCCACTCCACCGCCTTCCGTGCCCAAGATCGGAGACATCATCTCACC
AGTACATCCAGACCCAGCGCCTGTTCCGATAGCAGGGAACTGTCCTCTGT
CGACAGCCTGCTCCATTTCTGAAAAAAGTGAGGTCTTGGGATTGGGCCTG
GGAGTATCGGCAGCTGGACGGACGAATGGAGTTGGCCTTGGAGTTGAAAT
GCGAGGCGAGGACGAATTCACCTACTTCGGGTTGAGCGTTGCAGCGCAAA
TCCGTAATATGCCATTGGCCAGTGCCATGCTAATGCAGTCGAAAATCCAG
TATATGCTCTCTATGGAGCGTCGTAAGATTAACGGTCATCCTGGCGATAT
GGACATATTTCTAACTAAAAACGCAAGCTTTCTAGACCAT

BO28733.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 06:41:41
Subject Length Description Subject Range Query Range Score Percent Strand
CG30403-RB 909 CG30403-PB 1..906 17..922 4530 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 06:41:42
Subject Length Description Subject Range Query Range Score Percent Strand
CG30403-RB 1268 CG30403-RB 145..1051 16..922 4535 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 06:41:40
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 21710112..21710670 922..364 2795 100 Minus
2R 25286936 2R 21711121..21711469 364..16 1745 100 Minus
Blast to na_te.dros performed on 2014-11-27 06:41:40 has no hits.

BO28733.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-08-24 14:34:31 Download gff for BO28733.complete
Subject Subject Range Query Range Percent Splice Strand
CG30403-RB 142..1047 17..924 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 04:51:00 Download gff for BO28733.complete
Subject Subject Range Query Range Percent Splice Strand
CG30403-RB 146..1051 17..924 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 07:51:55 Download gff for BO28733.complete
Subject Subject Range Query Range Percent Splice Strand
CG30403-RB 146..1051 17..924 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 07:51:55 Download gff for BO28733.complete
Subject Subject Range Query Range Percent Splice Strand
2R 21711121..21711468 17..364 100   Minus
2R 21710110..21710669 365..924 99 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 04:51:00 Download gff for BO28733.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 17598626..17598973 17..364 100   Minus
arm_2R 17597615..17598174 365..924 99 <- Minus

BO28733.pep Sequence

Translation from 16 to 940

> BO28733.pep
MNSAVPPGVLGLPYRFSDERTVKFVELYGREPCLWNKRPYLRRARSAAYR
RIQSGINADIEPYESGLTIQGVKMKIKNLRTGYHQELKKIRTIPGYQPKT
PWFAPLHGFLAEFLDTNELETSIPQLKRLQIRLTRLKPIKIQTEIKPDPD
DLSVPDRPLDATPSSLFTVLPAPMPVEEPPTPPPSVPKIGDIISPVHPDP
APVPIAGNCPLSTACSISEKSEVLGLGLGVSAAGRTNGVGLGVEMRGEDE
FTYFGLSVAAQIRNMPLASAMLMQSKIQYMLSMERRKINGHPGDMDIFLT
KNASFLDH

BO28733.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 07:21:43
Subject Length Description Subject Range Query Range Score Percent Strand
CG30403-PB 302 CG30403-PB 1..302 1..302 1581 100 Plus