Clone BO28734 Report

Search the DGRC for BO28734

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:287
Well:34
Vector:pDNR-Dual
Associated Gene/TranscriptNT1-RB
Protein status:BO28734.pep: Imported from assembly
Sequenced Size:1396

Clone Sequence Records

BO28734.complete Sequence

1396 bp assembled on 2011-08-24

GenBank Submission: KX798865

> BO28734.complete
GAAGTTATCAGTCGACATGAAAGCTGGCCGCGCCTTCGGCTGCCTTTTCT
GGGCTCTGCTCTATTGTGTGCTCTATCTGGATCTGGTCAGTGGGAACTCC
GCCGACGATGAGCTGATGGACTTTGATTTTGCGGATTCAAATGATGCTGC
TATGGAGGACTGGCAGCTGGATGATCTGGAGGAGGCAAAAAAGGCGGAGC
AGGCCGAAAAGAAGTTGGAGTCGAATATGCTGGACTTTAGCGTAGATCTG
GATGAACCGGAGCCGGAGAAACAATTACCACCTTTCGATTGGCGAGAAAG
GGTTTTAAGAAACGCTCTGGCCAAAGCCTTGGCGGATGAGGGATTGCGCC
AGAAGTTCGCCGAAGTTTTGCCCATTTTAAGAATGCTATCTTCTCAACAG
CGCCTGGCTCTTTCCGCTTTGATCTCGGCTCAGATGAATGCAAAAAAGGG
GCACGAACTAAAGTTTGAACAGGTTCGCATGATGTTTGGCAATGAAAAAA
AGCTGCTTTTGCCCATAGTGTTCGACATCGCAAATCTCATAAAGAGCTCT
ACCCGCAAGTACATCAATCTGGGTTCTGATCTGGCTTCATCTGCCCTTTA
CCATACTCCCATCAATCGTCGTGAAGATGATTTGACTCCAGAAGAGTCCC
AACAGGATGACCAATTGGGCACCATTGCTGTGGAAGTTGAGCCAAAAAAG
GTCTCTACTGAGGAGGTGCAATTGGAGTCTCTAGAGGACTTCTTTGATGA
GATGGGGTCAGAAGTGCTTGATCCTCAGATGATCAATGAGGCCCTGACAG
GTGATCTTCATGATAACAAAACCAAGACTTTTAAACCAGAAAATCATGGT
CAAAGAGTTCGACGATCGGCAAACGAGTTTGTTCACAAATTGACCCGATC
CGTGCCTGCTTCTGTGACCGAGCAGCAACTTTTGGGTGGCATTGCTGGAC
GTACCATCAAGCTGAATACCACAGCTTTTCAACAGCCAAGTAGCCAGGAG
GAGGAGAAGATGGCCTCCTCCAATGGTGGCCAGTCATACTCTGAGGTGGA
GGATCTGGCTTTTGCTGGTCTTAATGGCACGGAAATCCCCCTGAGCGCTG
ATGAGCGATTAGATCTGCAAAGAAACAGCGCCGAGGAGACTGAGGAACCA
CTACCAAGTCCAGAGGAACTCATCGCTGGACCACGTTACCGACTGGGGAA
AAGACCACTGCCTGGTCAAAAATCTGGATCTCCCATCAAACGAAAGAGAG
TCACATCCTCCTTAAGGGGAAGACCGAAGACCGCCGCCAGTTCCCATAAA
CCCGTGGTTACACCACCCAACAAGAAATGCGAACGATTCACCAGCAACAT
GTGCATCCGAACCGACGACTATCCGCTGGCAAGCTTTCTAGACCAT

BO28734.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 06:39:29
Subject Length Description Subject Range Query Range Score Percent Strand
NT1-RE 1365 CG42576-PE 1..1362 17..1378 6810 100 Plus
NT1-RB 1365 CG42576-PB 1..1362 17..1378 6810 100 Plus
NT1-RC 1365 CG42576-PC 1..1362 17..1378 6810 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 06:39:30
Subject Length Description Subject Range Query Range Score Percent Strand
NT1-RE 1900 CG42576-RE 421..1782 17..1378 6810 100 Plus
NT1-RB 2012 CG42576-RB 533..1894 17..1378 6810 100 Plus
NT1-RC 1608 CG42576-RC 129..1490 17..1378 6810 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 06:39:27
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 4504403..4505311 1378..470 4545 100 Minus
3L 28110227 3L 4505398..4505855 474..17 2290 100 Minus
Blast to na_te.dros performed on 2014-11-27 06:39:28 has no hits.

BO28734.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-08-24 14:34:28 Download gff for BO28734.complete
Subject Subject Range Query Range Percent Splice Strand
NT1-RE 417..1778 17..1380 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 04:49:54 Download gff for BO28734.complete
Subject Subject Range Query Range Percent Splice Strand
NT1-RC 129..1490 17..1380 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 07:50:57 Download gff for BO28734.complete
Subject Subject Range Query Range Percent Splice Strand
NT1-RC 129..1490 17..1380 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 07:50:57 Download gff for BO28734.complete
Subject Subject Range Query Range Percent Splice Strand
3L 4505400..4505855 17..472 100   Minus
3L 4504401..4505308 473..1380 99 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 04:49:54 Download gff for BO28734.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 4505400..4505855 17..472 100   Minus
arm_3L 4504401..4505308 473..1380 99 <- Minus

BO28734.pep Sequence

Translation from 16 to 1396

> BO28734.pep
MKAGRAFGCLFWALLYCVLYLDLVSGNSADDELMDFDFADSNDAAMEDWQ
LDDLEEAKKAEQAEKKLESNMLDFSVDLDEPEPEKQLPPFDWRERVLRNA
LAKALADEGLRQKFAEVLPILRMLSSQQRLALSALISAQMNAKKGHELKF
EQVRMMFGNEKKLLLPIVFDIANLIKSSTRKYINLGSDLASSALYHTPIN
RREDDLTPEESQQDDQLGTIAVEVEPKKVSTEEVQLESLEDFFDEMGSEV
LDPQMINEALTGDLHDNKTKTFKPENHGQRVRRSANEFVHKLTRSVPASV
TEQQLLGGIAGRTIKLNTTAFQQPSSQEEEKMASSNGGQSYSEVEDLAFA
GLNGTEIPLSADERLDLQRNSAEETEEPLPSPEELIAGPRYRLGKRPLPG
QKSGSPIKRKRVTSSLRGRPKTAASSHKPVVTPPNKKCERFTSNMCIRTD
DYPLASFLDH

BO28734.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 07:21:23
Subject Length Description Subject Range Query Range Score Percent Strand
NT1-PH 1042 CG42576-PH 1..458 1..458 2318 99.1 Plus
NT1-PG 1042 CG42576-PG 1..458 1..458 2318 99.1 Plus
NT1-PD 886 CG42576-PD 1..458 1..458 2318 99.1 Plus
NT1-PF 1042 CG42576-PF 1..458 1..458 2318 99.1 Plus
NT1-PE 454 CG42576-PE 1..454 1..454 2317 100 Plus