Clone BO28738 Report

Search the DGRC for BO28738

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:287
Well:38
Vector:pDNR-Dual
Associated Gene/TranscriptCG5493-RA
Protein status:BO28738.pep: Imported from assembly
Sequenced Size:748

Clone Sequence Records

BO28738.complete Sequence

748 bp assembled on 2011-08-24

GenBank Submission: KX799896

> BO28738.complete
GAAGTTATCAGTCGACATGGCCCTGTCCAAGATCGACACCGAGATCGAGC
AGGTTGACCAGGAGAAGTACCTGCGTCAGGCCACTAGCTACTATCAGCCG
CTGGAGAAACCCCTGAAATACGGACCGGAGGTGAATTCCCTATCGGACTT
GGTGGCCGCCCTTCACCGGGAATTCGAGTCGAACTATGTTAACATCGAGA
TGGTGAATCACCTTATGCTCAGCTACAAGTCCAATCCGCGGGAGTGGCGC
AAATATGCCAAGTTCGATCGTTACACCTACACGCGGAATCTCGTGGATGC
TGGCAATGGAAAGTTCAATCTGCTGATTCTGTGCTGGGGCGAAGGACACG
GCTCCTCGGTGCACGACCATGCCGATTCCCATTGCTTCATGAAGATGCTG
AAGGGTGATCTGCGCGAGAAGCGCTACGAGTATCCCAATAGATCTGCCAG
GGACAACGGCCGGTCCCATCATCCCGATGGCGAGATCGATAGCCGAGAGC
TGGTGGAGATTGGGGAGACACCAATCGCCGTCAATGATGTGGCCTACATA
AATGACAATCTGGGTCTGCATCGCGTGGAGAACCCCAGCCATTCGGATAC
CTCTGTCTCCCTTCACCTATACTGTCCACCCTTCGACACGTGCTCCGTGT
TCCAGGACAACCTGAAGAAGACCACCGCCAAGGTCACCTTCTGGAGCAAA
TACGGCGTGAGGACGAAGCAGAACGAGCAGGCAAGCTTTCTAGACCAT

BO28738.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 06:43:01
Subject Length Description Subject Range Query Range Score Percent Strand
CG5493-RD 717 CG5493-PD 1..714 17..730 3570 100 Plus
CG5493-RC 717 CG5493-PC 1..714 17..730 3570 100 Plus
CG5493-RB 717 CG5493-PB 1..714 17..730 3570 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 06:43:02
Subject Length Description Subject Range Query Range Score Percent Strand
CG5493-RD 1031 CG5493-RD 63..776 17..730 3570 100 Plus
CG5493-RC 1130 CG5493-RC 162..875 17..730 3570 100 Plus
CG5493-RB 1161 CG5493-RB 193..906 17..730 3570 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 06:42:59
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 18617200..18617737 554..17 2690 100 Minus
2R 25286936 2R 18616947..18617123 730..554 885 100 Minus
Blast to na_te.dros performed on 2014-11-27 06:43:00 has no hits.

BO28738.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-08-24 14:34:34 Download gff for BO28738.complete
Subject Subject Range Query Range Percent Splice Strand
CG5493-RA 203..916 17..732 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 04:51:43 Download gff for BO28738.complete
Subject Subject Range Query Range Percent Splice Strand
CG5493-RB 193..906 17..732 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 07:52:28 Download gff for BO28738.complete
Subject Subject Range Query Range Percent Splice Strand
CG5493-RB 193..906 17..732 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 07:52:28 Download gff for BO28738.complete
Subject Subject Range Query Range Percent Splice Strand
2R 18617200..18617737 17..554 100   Minus
2R 18616945..18617122 555..732 98 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 04:51:43 Download gff for BO28738.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 14504705..14505242 17..554 100   Minus
arm_2R 14504450..14504627 555..732 98 <- Minus

BO28738.pep Sequence

Translation from 16 to 748

> BO28738.pep
MALSKIDTEIEQVDQEKYLRQATSYYQPLEKPLKYGPEVNSLSDLVAALH
REFESNYVNIEMVNHLMLSYKSNPREWRKYAKFDRYTYTRNLVDAGNGKF
NLLILCWGEGHGSSVHDHADSHCFMKMLKGDLREKRYEYPNRSARDNGRS
HHPDGEIDSRELVEIGETPIAVNDVAYINDNLGLHRVENPSHSDTSVSLH
LYCPPFDTCSVFQDNLKKTTAKVTFWSKYGVRTKQNEQASFLDH

BO28738.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 07:21:48
Subject Length Description Subject Range Query Range Score Percent Strand
CG5493-PD 238 CG5493-PD 1..238 1..238 1282 100 Plus
CG5493-PC 238 CG5493-PC 1..238 1..238 1282 100 Plus
CG5493-PB 238 CG5493-PB 1..238 1..238 1282 100 Plus
CG5493-PA 238 CG5493-PA 1..238 1..238 1282 100 Plus