Clone BO28740 Report

Search the DGRC for BO28740

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:287
Well:40
Vector:pDNR-Dual
Associated Gene/TranscriptCG10433-RA
Protein status:BO28740.pep: Imported from assembly
Sequenced Size:415

Clone Sequence Records

BO28740.complete Sequence

415 bp assembled on 2011-08-24

GenBank Submission: KX796383

> BO28740.complete
GAAGTTATCAGTCGACATGTCGCCGAGAAGGAGCTTGCTGTGCTGCCTGC
TGGTGAGCAGCATCCTAGTGCTGCACCAGGCTCAGGCCAACATCGAGACA
AACGATGTGAATGACCCCAGTTACTACATGCTGCAGGGTGTGCGTGTGTA
TCCCAATGACCGACAGTGCGTCATGGTCGGAGGACTGTGTGTCGCGGAGT
CGGACTGCATCGAACCCACCTCGAACAAGGGATTGTGTCCCACGAGTGCC
GGAGAGGGCGTGGAGTGCTGCTACGAACTGCCGGTCAGACCAGCGCCCTG
TGCGGAACACCTGGGACAGTGCATGGACCGATGCCACCAGAGGCTCCTGC
GACCCGGTTCGGATTGCAAGAATGGCCAAGTCTGCTGCGTCCTGATTGCA
AGCTTTCTAGACCAT

BO28740.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 06:43:18
Subject Length Description Subject Range Query Range Score Percent Strand
CG10433-RC 384 CG10433-PC 1..381 17..397 1905 100 Plus
CG10433-RA 384 CG10433-PA 1..381 17..397 1905 100 Plus
CG10433-RB 297 CG10433-PB 1..263 17..279 1315 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 06:43:19
Subject Length Description Subject Range Query Range Score Percent Strand
CG10433-RC 1945 CG10433-RC 1166..1546 17..397 1905 100 Plus
CG10433-RA 945 CG10433-RA 166..546 17..397 1905 100 Plus
CG10433-RB 1112 CG10433-RB 166..428 17..279 1315 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 06:43:16
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 21606468..21606617 278..129 750 100 Minus
2R 25286936 2R 21606075..21606193 397..279 595 100 Minus
2R 25286936 2R 21606681..21606792 128..17 560 100 Minus
Blast to na_te.dros performed on 2014-11-27 06:43:17 has no hits.

BO28740.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-08-24 14:34:35 Download gff for BO28740.complete
Subject Subject Range Query Range Percent Splice Strand
CG10433-RA 162..542 17..399 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 04:51:52 Download gff for BO28740.complete
Subject Subject Range Query Range Percent Splice Strand
CG10433-RA 166..546 17..399 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 07:52:35 Download gff for BO28740.complete
Subject Subject Range Query Range Percent Splice Strand
CG10433-RA 166..546 17..399 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 07:52:35 Download gff for BO28740.complete
Subject Subject Range Query Range Percent Splice Strand
2R 21606681..21606792 17..128 100   Minus
2R 21606468..21606617 129..278 100 <- Minus
2R 21606073..21606193 279..399 98 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 04:51:52 Download gff for BO28740.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 17494186..17494297 17..128 100   Minus
arm_2R 17493973..17494122 129..278 100 <- Minus
arm_2R 17493578..17493698 279..399 98 <- Minus

BO28740.pep Sequence

Translation from 16 to 415

> BO28740.pep
MSPRRSLLCCLLVSSILVLHQAQANIETNDVNDPSYYMLQGVRVYPNDRQ
CVMVGGLCVAESDCIEPTSNKGLCPTSAGEGVECCYELPVRPAPCAEHLG
QCMDRCHQRLLRPGSDCKNGQVCCVLIASFLDH

BO28740.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 07:21:50
Subject Length Description Subject Range Query Range Score Percent Strand
CG10433-PC 127 CG10433-PC 1..127 1..127 702 100 Plus
CG10433-PA 127 CG10433-PA 1..127 1..127 702 100 Plus
CG10433-PB 98 CG10433-PB 1..96 1..96 485 93.8 Plus