Clone BO28742 Report

Search the DGRC for BO28742

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:287
Well:42
Vector:pDNR-Dual
Associated Gene/TranscriptRbp1-RA
Protein status:BO28742.pep: Imported from assembly
Sequenced Size:439

Clone Sequence Records

BO28742.complete Sequence

439 bp assembled on 2011-08-24

GenBank Submission: KX796100

> BO28742.complete
GAAGTTATCAGTCGACATGCCGCGATATAGGGAGTGGGACTTGGCCTGCA
AGGTGTACGTGGGAAACCTGGGCTCCTCGGCGTCCAAGCACGAGATAGAA
GGCGCATTTGCCAAATATGGACCCCTGCGAAACGTGTGGGTGGCCCGCAA
TCCACCAGGTTTCGCCTTTGTCGAATTTGAGGATCGCCGTGACGCGGAAG
ACGCAACGCGTGCCCTGGACGGAACACGCTGCTGCGGCACTAGGATTCGC
GTAGAGATGTCTTCGGGTCGCTCGCGCGATCGCCGGCGCGGAGAAGGCGG
CAGTAGTGGTCGCTCTGGTTCCGGACGCTACAGGTCACGTTCGCCACGTC
GCTCCCGATCGCCCCGCAGCCGCAGCTTCTCGCGCGATCGTCGAAGTCGC
TCGGATTCTCGGGATCGTCATGCAAGCTTTCTAGACCAT

BO28742.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 06:44:12
Subject Length Description Subject Range Query Range Score Percent Strand
Rbp1-RA 408 CG17136-PA 1..405 17..421 2025 100 Plus
Rbp1-RD 435 CG17136-PD 1..318 17..334 1590 100 Plus
Rbp1-like-RC 477 CG1987-PC 19..224 35..240 460 81.6 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 06:44:13
Subject Length Description Subject Range Query Range Score Percent Strand
Rbp1-RA 773 CG17136-RA 149..553 17..421 2025 100 Plus
Rbp1-RD 1528 CG17136-RD 149..466 17..334 1590 100 Plus
Rbp1-like-RC 1456 CG1987-RC 208..413 35..240 460 81.6 Plus
Rbp1-RD 1528 CG17136-RD 1218..1308 331..421 455 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 06:44:10
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 10784607..10784925 17..335 1595 100 Plus
X 23542271 X 13384465..13384670 240..35 460 81.6 Minus
3R 32079331 3R 10786155..10786245 331..421 455 100 Plus
Blast to na_te.dros performed on 2014-11-27 06:44:11 has no hits.

BO28742.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-08-24 14:34:37 Download gff for BO28742.complete
Subject Subject Range Query Range Percent Splice Strand
Rbp1-RA 150..554 17..423 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 04:52:16 Download gff for BO28742.complete
Subject Subject Range Query Range Percent Splice Strand
Rbp1-RA 149..553 17..423 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 07:52:55 Download gff for BO28742.complete
Subject Subject Range Query Range Percent Splice Strand
Rbp1-RA 149..553 17..423 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 07:52:55 Download gff for BO28742.complete
Subject Subject Range Query Range Percent Splice Strand
3R 10786158..10786245 334..423 97   Plus
3R 10784607..10784923 17..333 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 04:52:16 Download gff for BO28742.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 6611880..6611967 334..423 97   Plus
arm_3R 6610329..6610645 17..333 100 -> Plus

BO28742.pep Sequence

Translation from 16 to 439

> BO28742.pep
MPRYREWDLACKVYVGNLGSSASKHEIEGAFAKYGPLRNVWVARNPPGFA
FVEFEDRRDAEDATRALDGTRCCGTRIRVEMSSGRSRDRRRGEGGSSGRS
GSGRYRSRSPRRSRSPRSRSFSRDRRSRSDSRDRHASFLDH

BO28742.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 07:21:53
Subject Length Description Subject Range Query Range Score Percent Strand
Rbp1-PA 135 CG17136-PA 1..135 1..135 715 100 Plus
Rbp1-like-PC 158 CG1987-PC 1..158 1..135 591 75.5 Plus
Rbp1-like-PA 158 CG1987-PA 1..158 1..135 591 75.5 Plus
Rbp1-PD 144 CG17136-PD 1..121 1..121 580 90.9 Plus
Rbp1-like-PB 247 CG1987-PB 1..101 1..101 479 88.1 Plus